Homologous proteins - amino acid sequence in fasta format, Biology

Assignment Help:

Please answer the following question on Sequence Y:

Protein databases

1. What sequence from which organism is this sequence most similar to?

2. Can you find any homologues of this protein in other organisms? Can you find any clues to the function of these homologous proteins?

3. Does this protein contain any known conserved sequence motifs or domains?

4. Can you name any two protein domain databases other than Pfam?

Here is an amino acid sequence in fasta format:

>Sequence Y

MEKGEKPLLLFEEQKKRITNLIDDFLNGLKQIMNEEEEFIASKLDVIQKLRMDLRLLRTFVLFGNSTNLDDF

YYRMNIHINKFNILTETLFCKDDLILEKYHMECVAPLLLKEIRNYLSLKNDYVATAIEMKKFEYLIRNLHDL

PKYCYDLLQPLMSEYKILRQVCTHLRDFYQLECNKTTKTEFLYTRYQVTVDRVTQFCFDLWTGKYRNYRYEY

AFSKCSSKITSLLIDIIPLELEVLHISTSNLIKESRSKELEGFVKQILKASPRILQKHLIHLQGRMVADSYS

ATQSINVMMEFLLIFLTDIPKRFIHRGKLNSMLAHVGLLTRKISILMEESSTMNEAEFSAPYLLHEIERMKG

DIKQIILKAPESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDES

TSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKS

SYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRA

KCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERG

NRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVL

IAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTP

VSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDFCSV

KAGKEKFFKLINSGDPFHASDFLHHRLTIHTDDKKCVLFNSNKCSAGSKHLISLEVSSSLDNFGYIFHTRHM

RLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLS

KLKHVSIDQSSFFDKEEVEVEVEEEEEVEVEVEEEDEDKEEEDTDNIQSRILEGENSKLTTLSKVDISYSQG

TNDALEKFQNLEHLDCTIIVPECPPKHGDWFPKFDVLNKLQSLTAVYKWSHYGYPIIEYHFPTSLKDLRLHS

FPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILE

RCYKLTEIPSAFEDIETLKIIHLTNIKRELGDSAIEIKKQIVEITGVDRLQVHLSGLYE

 


Related Discussions:- Homologous proteins - amino acid sequence in fasta format

What body system hiv impairs, Given that most AIDS victims die from overwhe...

Given that most AIDS victims die from overwhelming infections or rare types of cancer, what body system do you think HIV (the AIDS virus) impairs?

What is benedict's test and its principle, What is Benedict's Test and its ...

What is Benedict's Test and its Principle? This test is answered by all reducing sugars with a free aldehyde or ketone groups. Monosaccharides possess a free aldehyde or ketone

Explain the biochemical approach in taxonomy, Explain the Biochemical Appro...

Explain the Biochemical Approach in Taxonomy Comparative biochemistry is being used increasingly in the systematic of animals, both for identification of organisms as well as f

How proteins can be classified, How Proteins can be Classified? I. Shap...

How Proteins can be Classified? I. Shape and size: fibrous proteins and globular proteins. Fibrous proteins play structural roles  in organisms. Globular proteins consist of lo

Explain procedure for sub-culturing of a culture, Explain Procedure for Sub...

Explain Procedure for Sub-Culturing of a Culture Now carry out the exercise following the steps given herewith: 1. Sterilize the inoculating loop and needle by heating to re

What are examples of the ecological and economic, What are examples of the ...

What are examples of the ecological and economic importance of molluscs? Molluscs are significant players in several food chains in ecosystems. Many marine molluscs are part of

Pulmonary valvotomy with infundibular resection, Pulmonary Valvotomy with I...

Pulmonary Valvotomy with Infundibular Resection :  Infundibular obstruction in cases of pulmonary valvar stenosis could be primary or secondary. 11' this obstruction is signi

How folate is important for pregnant women, How Folate is Important For Pre...

How Folate is Important For Pregnant Women? Folate is also important for pregnant women. Low blood levels of folate during pregnancy can cause neural tube defects-anencephaly (

What is the phellogen? what its function, What is the phellogen? What its f...

What is the phellogen? What its function? The Phellogen also called as cork cambium is the meristematic plant tissue responsible for the formation of the periderm (the covering

Medical therapy for aortic stenosis, Q. Medical Therapy for aortic stenosis...

Q. Medical Therapy for aortic stenosis? Definitive therapy for aortic stenosis is surgical and medical therapy is only palliative. Infective endocarditis and rheumatic fever p

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd