Homologous proteins - amino acid sequence in fasta format, Biology

Assignment Help:

Please answer the following question on Sequence Y:

Protein databases

1. What sequence from which organism is this sequence most similar to?

2. Can you find any homologues of this protein in other organisms? Can you find any clues to the function of these homologous proteins?

3. Does this protein contain any known conserved sequence motifs or domains?

4. Can you name any two protein domain databases other than Pfam?

Here is an amino acid sequence in fasta format:

>Sequence Y

MEKGEKPLLLFEEQKKRITNLIDDFLNGLKQIMNEEEEFIASKLDVIQKLRMDLRLLRTFVLFGNSTNLDDF

YYRMNIHINKFNILTETLFCKDDLILEKYHMECVAPLLLKEIRNYLSLKNDYVATAIEMKKFEYLIRNLHDL

PKYCYDLLQPLMSEYKILRQVCTHLRDFYQLECNKTTKTEFLYTRYQVTVDRVTQFCFDLWTGKYRNYRYEY

AFSKCSSKITSLLIDIIPLELEVLHISTSNLIKESRSKELEGFVKQILKASPRILQKHLIHLQGRMVADSYS

ATQSINVMMEFLLIFLTDIPKRFIHRGKLNSMLAHVGLLTRKISILMEESSTMNEAEFSAPYLLHEIERMKG

DIKQIILKAPESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDES

TSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKS

SYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRA

KCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERG

NRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVL

IAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTP

VSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDFCSV

KAGKEKFFKLINSGDPFHASDFLHHRLTIHTDDKKCVLFNSNKCSAGSKHLISLEVSSSLDNFGYIFHTRHM

RLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLS

KLKHVSIDQSSFFDKEEVEVEVEEEEEVEVEVEEEDEDKEEEDTDNIQSRILEGENSKLTTLSKVDISYSQG

TNDALEKFQNLEHLDCTIIVPECPPKHGDWFPKFDVLNKLQSLTAVYKWSHYGYPIIEYHFPTSLKDLRLHS

FPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILE

RCYKLTEIPSAFEDIETLKIIHLTNIKRELGDSAIEIKKQIVEITGVDRLQVHLSGLYE

 


Related Discussions:- Homologous proteins - amino acid sequence in fasta format

DNA, what is the genetic code of life

what is the genetic code of life

What are the symptoms of diverticulosis, Q. What are the symptoms of divert...

Q. What are the symptoms of diverticulosis? Depending on the site of diverticula the symptoms may appear. It occurs most often in sigmoid colon and frequency increases with age

Indications for coronary artery bypass surgery, Indications for Coronary Ar...

Indications for Coronary Artery Bypass Surgery :  The modalities of treatment for coronary artery disease iuc: (1) medical, (2) angioplasty and stenting, and (3) coronary arte

Why overwatering a potted tomato plant will kill it, Consistently overwater...

Consistently overwatering a potted tomato pla nt will eventually kill it. Using the map, suggest why waterlogged soil results in plant death. O2 cannot reach respiring root cells.

Explain the vitamin k dependent proteins, Explain the Vitamin K dependent p...

Explain the Vitamin K dependent proteins? The four vitamin K-dependent procoagulants (factor II or prothrombin, and factors VII, IX, and X), about which we studied above, are s

Is transpiration the only way by which leaves lose water, Is transpiration ...

Is transpiration the only way through which leaves lose water? Plants do not only lose water as vapor, as by transpiration. The leaves also lose liquid water by a phenomenon c

Food and diet, could you survive on a diet which contain no carbohydrates

could you survive on a diet which contain no carbohydrates

What percentage of the offspring will have purple flowers, Purple(P) flower...

Purple(P) flowers are dominant and white(p) flowers are recessive. A homozygous dominant purple flower is crossed with a homozygous recessive white flower. what percentage of the o

Discuss about nerve to mylohyoid, Nerve to Mylohyoid Motor branch of i...

Nerve to Mylohyoid Motor branch of inferior dental nerve which descends in a groove on the medial surface of the mandibular ramus. Surgical intervention in this area may lead

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd