Homologous proteins - amino acid sequence in fasta format, Biology

Assignment Help:

Please answer the following question on Sequence Y:

Protein databases

1. What sequence from which organism is this sequence most similar to?

2. Can you find any homologues of this protein in other organisms? Can you find any clues to the function of these homologous proteins?

3. Does this protein contain any known conserved sequence motifs or domains?

4. Can you name any two protein domain databases other than Pfam?

Here is an amino acid sequence in fasta format:

>Sequence Y

MEKGEKPLLLFEEQKKRITNLIDDFLNGLKQIMNEEEEFIASKLDVIQKLRMDLRLLRTFVLFGNSTNLDDF

YYRMNIHINKFNILTETLFCKDDLILEKYHMECVAPLLLKEIRNYLSLKNDYVATAIEMKKFEYLIRNLHDL

PKYCYDLLQPLMSEYKILRQVCTHLRDFYQLECNKTTKTEFLYTRYQVTVDRVTQFCFDLWTGKYRNYRYEY

AFSKCSSKITSLLIDIIPLELEVLHISTSNLIKESRSKELEGFVKQILKASPRILQKHLIHLQGRMVADSYS

ATQSINVMMEFLLIFLTDIPKRFIHRGKLNSMLAHVGLLTRKISILMEESSTMNEAEFSAPYLLHEIERMKG

DIKQIILKAPESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDES

TSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKS

SYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRA

KCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERG

NRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVL

IAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTP

VSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDFCSV

KAGKEKFFKLINSGDPFHASDFLHHRLTIHTDDKKCVLFNSNKCSAGSKHLISLEVSSSLDNFGYIFHTRHM

RLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLS

KLKHVSIDQSSFFDKEEVEVEVEEEEEVEVEVEEEDEDKEEEDTDNIQSRILEGENSKLTTLSKVDISYSQG

TNDALEKFQNLEHLDCTIIVPECPPKHGDWFPKFDVLNKLQSLTAVYKWSHYGYPIIEYHFPTSLKDLRLHS

FPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILE

RCYKLTEIPSAFEDIETLKIIHLTNIKRELGDSAIEIKKQIVEITGVDRLQVHLSGLYE

Related Discussions:- Homologous proteins - amino acid sequence in fasta format

Potassium (k) - macronutrients, Potassium (K) - Macronutrients The mai...

Potassium (K) - Macronutrients The main source of K + for plants comes from withering of K containing minerals. Potassium released by withering dissolves in the soil solution

Which compounds does not contain an amine, Which of the following compounds...

Which of the following compounds does NOT contain an amine? Select one: a. Glutamine b. Acetate ion c. Urea d. Guanidinium ion e. Creatine

Sensor measures the current value of the controlled variable, In a properly...

In a properly functioning negative feedback system A. value of the controlled variable will always be very close to the threshold value when the system is in steady state.

Explain in brief about leukotrienes and prostaglandins, Leukotrienes and pr...

Leukotrienes and prostaglandins are produced only when the mast cell undergo degranulation and enzymatic break down of phospholipids in the plasma membrane. The effects formed b

Describe the examination of abdomen, Describe the Examination of Abdomen ? ...

Describe the Examination of Abdomen ? The contour of abdomen is to be recorded. Normally the abdomen is scaphold in sharp in a young adult. In case of fullness and bulge presen

Horse diseases-vesicular stomatitis, Vesicular stomatitis Vesicular stomat...

Vesicular stomatitis Vesicular stomatitis (VS) is an infectious viral disease of horses, cattle and pigs caused by Vesiculovirus of the family Rhabdoviridae and characterized by f

Define metabolic utilization of carbohydrates, Define Metabolic utilization...

Define Metabolic utilization of carbohydrates? Following absorption, the monosaccharides enter the portal circulation and are carried to the liver. Both galactose and fructose

Empyema, Empyema: Empyema is accumulation of thick pus in the pleural...

Empyema: Empyema is accumulation of thick pus in the pleural cavity. Primary infection of pleura does not arise so the pathology may either be in chest wall, mediastinum or t

Define rna synthesis , The general mechanism of RNA synthesis by these euk...

The general mechanism of RNA synthesis by these eukaryotic RNA polymerases is the same as for the prokaryotic enzyme that is: ? The initiation of RNA synthesis by RNA polyme

Describe nerve cells, In eukaryotes possibly the most rapid and complex sig...

In eukaryotes possibly the most rapid and complex signaling is mediated through nerve impulses. The Nerve cells (neurons) consist of a cell body with numerous projections

Write Your Message!

Name

Email id

Message

Verfication Code

User Account

All Pages