Homologous proteins - amino acid sequence in fasta format, Biology

Assignment Help:

Please answer the following question on Sequence Y:

Protein databases

1. What sequence from which organism is this sequence most similar to?

2. Can you find any homologues of this protein in other organisms? Can you find any clues to the function of these homologous proteins?

3. Does this protein contain any known conserved sequence motifs or domains?

4. Can you name any two protein domain databases other than Pfam?

Here is an amino acid sequence in fasta format:

>Sequence Y

MEKGEKPLLLFEEQKKRITNLIDDFLNGLKQIMNEEEEFIASKLDVIQKLRMDLRLLRTFVLFGNSTNLDDF

YYRMNIHINKFNILTETLFCKDDLILEKYHMECVAPLLLKEIRNYLSLKNDYVATAIEMKKFEYLIRNLHDL

PKYCYDLLQPLMSEYKILRQVCTHLRDFYQLECNKTTKTEFLYTRYQVTVDRVTQFCFDLWTGKYRNYRYEY

AFSKCSSKITSLLIDIIPLELEVLHISTSNLIKESRSKELEGFVKQILKASPRILQKHLIHLQGRMVADSYS

ATQSINVMMEFLLIFLTDIPKRFIHRGKLNSMLAHVGLLTRKISILMEESSTMNEAEFSAPYLLHEIERMKG

DIKQIILKAPESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDES

TSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKS

SYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRA

KCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERG

NRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVL

IAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTP

VSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDFCSV

KAGKEKFFKLINSGDPFHASDFLHHRLTIHTDDKKCVLFNSNKCSAGSKHLISLEVSSSLDNFGYIFHTRHM

RLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLS

KLKHVSIDQSSFFDKEEVEVEVEEEEEVEVEVEEEDEDKEEEDTDNIQSRILEGENSKLTTLSKVDISYSQG

TNDALEKFQNLEHLDCTIIVPECPPKHGDWFPKFDVLNKLQSLTAVYKWSHYGYPIIEYHFPTSLKDLRLHS

FPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILE

RCYKLTEIPSAFEDIETLKIIHLTNIKRELGDSAIEIKKQIVEITGVDRLQVHLSGLYE

Related Discussions:- Homologous proteins - amino acid sequence in fasta format

What do you mean by cytotaxonomu and biosustematics, Q. What do you mean by...

Q. What do you mean by Cytotaxonomu and biosustematics? Towards the end of the 19 th century and in the early years of the 20th century, botanists were faced with a problem of

Determine the chain in the dna molecule, Which type of chemical bond mainta...

Which type of chemical bond maintains the pairing of each chain in the DNA molecule? To produce the DNA molecule, purine bases bind to pyrimidine bases by intermolecular bonds

Explain sodium, Explain Sodium Sodium (Nu) : In sodium-restricted di...

Explain Sodium Sodium (Nu) : In sodium-restricted diets, no salt is added to the diet which still provides approximately 50 mmoL Na. Foods containing high Na content must b

Describe new cardio-vascular risk factors, Describe New Cardio-vascular Ris...

Describe New Cardio-vascular Risk Factors ? The major risk factors contributing to the development of atherosclerotic plaques in blood vessels have been known for many years. H

Define the translocation of food through sieve tubes, Arrange the following...

Arrange the following processes sequentially to define the translocation of food through sieve tubes. i. Unloading of sugar in sink cells (or cells of root). ii. Uptak

Define the plasma membrane and its function, Similar to all animal cells, p...

Similar to all animal cells, protozoans are covered by a plasma membrane which surrounds cytoplasm of the cell, protozoan's integument or skin. Like all membranes, it's permeable;

What are degenerative diseases, Q. What are degenerative diseases? The ...

Q. What are degenerative diseases? The Degenerative diseases are non-infectious prevalent diseases whose incidences increase with aging.

How do the rough endoplasmic reticulum produce proteins, How do the rough e...

How do the rough endoplasmic reticulum and the Golgi apparatus act in the production and releasing of proteins? The rough endoplasmic reticulum has in its outer membrane many r

Discuss the following term in brief - adaptive radiation, Discuss the follo...

Discuss the following term in brief - Adaptive radiation Evolution of a variety of different species from a single common ancestor. Each is adapted for a particular niche, and

Define introduction of lipids, Define Introduction of Lipids? You have ...

Define Introduction of Lipids? You have studied that lipids together with carbohydrates and proteins are important as food for many animals. Lipids include neutral fats, phosph

Write Your Message!

Name

Email id

Message

Verfication Code

User Account

All Pages