Homologous proteins - amino acid sequence in fasta format, Biology

Assignment Help:

Please answer the following question on Sequence Y:

Protein databases

1. What sequence from which organism is this sequence most similar to?

2. Can you find any homologues of this protein in other organisms? Can you find any clues to the function of these homologous proteins?

3. Does this protein contain any known conserved sequence motifs or domains?

4. Can you name any two protein domain databases other than Pfam?

Here is an amino acid sequence in fasta format:

>Sequence Y

MEKGEKPLLLFEEQKKRITNLIDDFLNGLKQIMNEEEEFIASKLDVIQKLRMDLRLLRTFVLFGNSTNLDDF

YYRMNIHINKFNILTETLFCKDDLILEKYHMECVAPLLLKEIRNYLSLKNDYVATAIEMKKFEYLIRNLHDL

PKYCYDLLQPLMSEYKILRQVCTHLRDFYQLECNKTTKTEFLYTRYQVTVDRVTQFCFDLWTGKYRNYRYEY

AFSKCSSKITSLLIDIIPLELEVLHISTSNLIKESRSKELEGFVKQILKASPRILQKHLIHLQGRMVADSYS

ATQSINVMMEFLLIFLTDIPKRFIHRGKLNSMLAHVGLLTRKISILMEESSTMNEAEFSAPYLLHEIERMKG

DIKQIILKAPESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDES

TSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKS

SYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRA

KCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERG

NRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVL

IAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTP

VSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDFCSV

KAGKEKFFKLINSGDPFHASDFLHHRLTIHTDDKKCVLFNSNKCSAGSKHLISLEVSSSLDNFGYIFHTRHM

RLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLS

KLKHVSIDQSSFFDKEEVEVEVEEEEEVEVEVEEEDEDKEEEDTDNIQSRILEGENSKLTTLSKVDISYSQG

TNDALEKFQNLEHLDCTIIVPECPPKHGDWFPKFDVLNKLQSLTAVYKWSHYGYPIIEYHFPTSLKDLRLHS

FPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILE

RCYKLTEIPSAFEDIETLKIIHLTNIKRELGDSAIEIKKQIVEITGVDRLQVHLSGLYE

 


Related Discussions:- Homologous proteins - amino acid sequence in fasta format

Define the properties of fibre, Define the Properties of Fibre? The str...

Define the Properties of Fibre? The structural make up of fibre influences its properties which in turn affects the physiologic and metabolic roles. This is well-depicted in th

Hypnotic or anxiolytic intoxication and withdrawal, Barbiturate, Sedative, ...

Barbiturate, Sedative, Hypnotic or Anxiolytic Intoxication and Withdrawal: This Emergencies related  to  substance abuse may be acute  or chronic. The patient may come  to  th

Define carbohydrate metabolism - ageing, Define Carbohydrate metabolism - A...

Define Carbohydrate metabolism - Ageing? Glucose tolerance may be impaired to some extent. Usually, the fasting blood sugar is normal. The absorption of carbohydrate is not im

Genetics, discuss chromosomal theory of heredity.

discuss chromosomal theory of heredity.

Hybridoma, Hybridoma is the clone of plasmacytoma cells which secrete a mo...

Hybridoma is the clone of plasmacytoma cells which secrete a monoclonal antibody; commonly produced by the fusion of peripheral or splenic plasma cells taken from the immunized mo

Hand washing in sterilization process, Q. Hand Washing in sterilization pro...

Q. Hand Washing in sterilization process? Hand washing is considered the single most important measure to reduce the risk of transmitting organisms to patients and HCWs (health

Explain about pre-market approval application, Question 1: Show the pro...

Question 1: Show the procedures for filing a 510(k) application and a Pre-market approval application for medical devices in the USA. Show out the procedures for filing a

Describe the male reproductive system, Describe the Male Reproductive Syste...

Describe the Male Reproductive System? In addition to the primary sex organs, the testes, there are accessory structures that store, nourish, and activate the sperm, and conduc

Parthenogenesis- asexual reproduction, Normal 0 false false ...

Normal 0 false false false EN-IN X-NONE X-NONE MicrosoftInternetExplorer4

What is population density, Q. What is population density? The Populati...

Q. What is population density? The Population density is the relation between the number of individuals of a population and the area or volume they occupy. For instance, in 200

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd