Homologous proteins - amino acid sequence in fasta format, Biology

Assignment Help:

Please answer the following question on Sequence Y:

Protein databases

1. What sequence from which organism is this sequence most similar to?

2. Can you find any homologues of this protein in other organisms? Can you find any clues to the function of these homologous proteins?

3. Does this protein contain any known conserved sequence motifs or domains?

4. Can you name any two protein domain databases other than Pfam?

Here is an amino acid sequence in fasta format:

>Sequence Y

MEKGEKPLLLFEEQKKRITNLIDDFLNGLKQIMNEEEEFIASKLDVIQKLRMDLRLLRTFVLFGNSTNLDDF

YYRMNIHINKFNILTETLFCKDDLILEKYHMECVAPLLLKEIRNYLSLKNDYVATAIEMKKFEYLIRNLHDL

PKYCYDLLQPLMSEYKILRQVCTHLRDFYQLECNKTTKTEFLYTRYQVTVDRVTQFCFDLWTGKYRNYRYEY

AFSKCSSKITSLLIDIIPLELEVLHISTSNLIKESRSKELEGFVKQILKASPRILQKHLIHLQGRMVADSYS

ATQSINVMMEFLLIFLTDIPKRFIHRGKLNSMLAHVGLLTRKISILMEESSTMNEAEFSAPYLLHEIERMKG

DIKQIILKAPESSQLCFPMDDGFLFMNLLLRHLNDLLTSNSYSVSLIKKEIEMVKQSLEFLTASFRQTLDES

TSGVVKDCWMCALDVAYEAEHVINSILVRDKALSHLLFSLPDVIDKIKFIVAQVTGLQLEAKNGDDPLDAKS

SYEPIELTSSSFVEVTVGHEEDEARIIGQLLDEHESKLDVISIVGMPGVGKTTLANKVYNNTLVASHFKIRA

KCTVSQNFNKSKVLREILQQVTASETNRSEDDLAEKLRVALLDKRYLIVLDDVWDIATGEMLIACFPKVERG

NRVILTSRSGEVGLKVKCRSDPVDLQVLTDEKSWELFEKRVFRDEGSCPAELLDIGHQIVEKCKGLPLALVL

IAGVIVRGREGKEKEKEKDFWVKIQNNLDSFTSSNINSQIMNVMQSSYDHLPYQLKPLLLYFARLQKSERTP

VSMLMQLWMAEGLVDHDIPSKCSLEEVTESYLDALISSSLIMVDHIRSVSNWTSVMMRACYVHDVVHDFCSV

KAGKEKFFKLINSGDPFHASDFLHHRLTIHTDDKKCVLFNSNKCSAGSKHLISLEVSSSLDNFGYIFHTRHM

RLVRVLQLDDIVLQHHLVEEIGSLFHLRFLKIWTRDVKAIPLSWLNLQNLETLLISEEFSTIVLLPRLFKLS

KLKHVSIDQSSFFDKEEVEVEVEEEEEVEVEVEEEDEDKEEEDTDNIQSRILEGENSKLTTLSKVDISYSQG

TNDALEKFQNLEHLDCTIIVPECPPKHGDWFPKFDVLNKLQSLTAVYKWSHYGYPIIEYHFPTSLKDLRLHS

FPITPALLSVIAALPQLEILAIFYSDFMEDKWDASKDIYQSLKTLSLSYIKLSEWEVDRSETFPKLEELILE

RCYKLTEIPSAFEDIETLKIIHLTNIKRELGDSAIEIKKQIVEITGVDRLQVHLSGLYE

Related Discussions:- Homologous proteins - amino acid sequence in fasta format

Biota of the neritic oceanic zone, Biota of the Neritic Oceanic Zone T...

Biota of the Neritic Oceanic Zone This zone constitutes 75 per cent of the total oceanic area and is relatively rich in species and high in productivity owing to factors such

Tubal pregnancy, what si tubal pregnancy ,

what si tubal pregnancy ,

What is the function of the plant cell wall, Ans) The plant cell wall has s...

Ans) The plant cell wall has structural and protective functions. It plays significant role in the constraint of the cell size, preventing the cell to break when it absorbs much wa

Active transport, Active transport is the transport of the molecules again...

Active transport is the transport of the molecules against the concentration gradient (from area of low concentration to area of high concentration) with the help of proteins in t

Optical rotation in organice compounds, how the optical rotaion occurs in g...

how the optical rotaion occurs in glucose and ribose?

Signal transduction, Signal Transduction The body consists of a huge va...

Signal Transduction The body consists of a huge variety of cell types which must work together to sustain the life of an organism. They must respond to their environment and co

Meat product quality assurance, P r o d u c t Quality Assurance M...

P r o d u c t Quality Assurance Meat products should be manufactured under strict hygiene and sanitary conditions to avoid public health risks and improve aesthetic appea

Temperature-environmental components, TEMPERATURE Temperature is a majo...

TEMPERATURE Temperature is a major physical environmental factor which profoundly influences the vital activities of living organisms like, metabolism, growth and reproduction.

Cell Coat, What role would a cell coat play if it was a part of a city?

What role would a cell coat play if it was a part of a city?

What do you understand by pseudocoelomate?, What do you understand by Pseud...

What do you understand by Pseudocoelomate? Animals that have a body cavity which is not completely lined by mesoderm. In past these organisms were referred to as the phylum Asc

Write Your Message!

Name

Email id

Message

Verfication Code

User Account

All Pages