Effect of single base pair mutation on the cftr protein, Biology

Assignment Help:

Cystic fibrosis (CF) is caused by a variety of mutations in the CFTR gene. Imagine you have identified a new single-base pair mutation (A→T) in an exon of the CFTR gene. You wish to use an RFLP approach to determine the proportion of carriers and CF patients (CF patients must have two copies of the defective gene to have the disease) that harbour this particular mutation. 

Wild type (normal) CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGAAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

(Protein sequence:LRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVL)

Mutant CFTR sequence:

5'...

CTCAGATCTGTGATAGAACAGTTTCCTGGGTAGCTTGACTTTGTCCTTGT

GGATGGGGGCTGTGTCCTAAGCCATGGCCACAAGCAGTTGATGTGCTTG

GCTAGATCTGTTCTCAG...3'

a) Mark on the sequences the locations (if present) of

1986_Effect of single base pair mutation on the cftr protein.png

recognition sites for the 6 restriction enzymes listed (BglII, EcoRI, NlaIII, AluI, HaeIII and HindIII)

b) What specific effect will the single base pair mutation have on the CFTR protein?   

c) Choose an appropriate pair of enzymes to perform RFLP by southern blot on this sequence; you must select a combination of enzymes that will distinguish the wild type and mutant alleles. Explain your reasoning.   

d) Draw the pattern of results you would see following RFLP (using the pair of enzymes chosen above) on a healthy individual, a heterozygous carrier of this mutation, or a cystic fibrosis patient carrying this mutation. NB - assume that the probe used in blotting hybridises to a region from base pair 10 to base pair 105 (i.e. most of the sequence).


Related Discussions:- Effect of single base pair mutation on the cftr protein

Sporophytic incompatibility, Sporophytic Incompatibility The recogniti...

Sporophytic Incompatibility The recognition and rejection reactions in a SSI system occur on the stigma surface, placing barriers for pollen germination or penetration of poll

Criteria for identifying biodiversity hot spots, A simple method used to id...

A simple method used to identify areas of high conservation priority is the selection of countries according to highest species richness. Among the top 12 countries identified this

Difference between ectoparasite and endoparasite, What is the difference be...

What is the difference between ectoparasite and endoparasite? Ectoparasites are parasites that explore the external surface of the host (as, for example, mites that parasite th

Zoology, give the discriptive account of nerilla which belongs to class a...

give the discriptive account of nerilla which belongs to class arciannelida in phylum annelida

Describe about the implant surgeon, Describe about The implant surgeon ...

Describe about The implant surgeon The implant surgeon should have basic knowledge of the macroscopic and microscopic anatomy of the jaw bones with their associated neurovascul

Induction of disease resistance in plants by heat-shock, Induction of disea...

Induction of disease resistance in plants by heat-shock The fungus Cladosporium cucumerinum infects cucumber and causes disease in the plant. However, if seedling of cucumber

How can nutrients are classified, Q. According to their functions how can n...

Q. According to their functions how can nutrients are classified? One possible and utile functional classification for nutrients is the one that separates them into energetic,

Explain rectangular full mucoperiosteal flaps, Explain Rectangular Full Muc...

Explain Rectangular Full Mucoperiosteal Flaps - Endodontic Surgery      a. Releasing and relaxing "vertical" incisions, with the Horizontal incision, b. Causes re

Fine structure of pollen tubes grown in vitro, Fine Structure of Pollen Tub...

Fine Structure of Pollen Tubes Grown in Vitro The growth in pollen tubes is exclusively restricted to the tip. Cytochemical analysis reveals the pollen tip zone to be rich in

Pulmonary embolism, Systemic Infection Serious infections increase total...

Systemic Infection Serious infections increase total body metabolism and thus impose hemodynamic burden on the heart. Increased heart rate associated with infections is an addit

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd