Cracking the Vigenere Cipher, Computer Network Security

Assignment Help:

The following message was enciphered with a Vigenère cipher.

aikiaawgfspxeppvjabjnivulfznzvkrlidamsmyamlvskniyffdpbwtnxsvvbtnamvltsefoeycztkomylmerkwrs

deusjgecmzkwvnreeypnnosdahjepkujejwttymoeatnvtipafsvgjnvtrlkauiwertshdtasqmfaooltxjiehrzmcpcosdiz

szukzezpeoehevrrajlsarlmzjimayddscnyzsyahnczucvqnkptywmedpbllwqedpzliuagieysaljtismaeowzllghpiifijt

padeegedszfgrtsuikhnyrucqhbpcaugqnymeujscppdrxxrrehzkarevauemgttnxvvvnvdiazvnrwyaprdlneqjbxsaj

gzrrnodwetrziearwucydsxpharvnmrwdolllnmatffweeeuifxbtsegjiziprcwetuphrkwreytywqghconfmaaetywhreae

evavtsbfllzaycywwgecccmffaydeganrdeespseltljmagtnkzivrqiikxsofrdsxphpsffxueqiolyeewijlwbpprystfiesegw

hrarzkighltkzivrqiikxrvprkjmctztywizicakwwpoxejomghehvewgiwlcgsxiygwgvghpiixmesepfargszfkzifelsffwniyt

jsvrtseffpltpadarghppiwqveclvskhejeklsteeowxxuexaiceadehvjinrppcwrgyzfjlegslrfmrqsfgxwwgiyggjszoeeulin

mdwygpbsptywmeftrjlxurpexsqrslrvvsbmpdfxgbucsvllryweuskniysktsghnikqeadfnzliqsnoiartthitwmaelcyyeze

ehvzszeoewwegtztygwrthocsxrrzbzfznnaeikmrgzackjbrfnzliqmfskzeiemevftnreitmpnrwyxspyiygrfhghptnwrgy

oewwegbjwzyeaaeskeeeydijhvrctsvdcghpsfjxbfcejmpgtsepzeieeornsvdtfkzilrptfymieehvewrlgejshrcpnkuln

nnefxwgajieyycacsvfeywprvaqcrpsjazrllsklmzezukarntheelcjiyakdmiecpfgpjiehcmonsaougpfktaevwnneits

dbrwajuseiygkzivrqiikxtolljxsetsetdyotsepoieelljgeespnrdwsicskysnldowllrspajgrzodtcqqvsqiiartaeoewiad

ehvyyanprjzeiemevfwbltdrlxueztywvrnoowllrptttzxurpetdinndhvwxfiyaigazavejaxghpccmffbpskkxnretfswra

doeviseyszniyyqoiwmtheyvakutjerjwghpymwrrvprxgrrfzuiyezedwzllbuecffgrdtnxsxghpsksvgoqajwefoyiellrtz

puazvstoesrqielctivneeiwwgiygkgwretfcswgspajgrftzpjuseecszfxuenhretvoysyatrirhkqjvvpcrfxeofbcwxuexhv

jinfeeizeiiygjgqrsfctwwfarazfwgtsedsrphpskwvplfbjaxfbpeesauiwejarpeehvkigwzccmffllskeigiytywpraruvwzv

dpntwhoyehvxeptehrlwbuehretgoyscswgvtszlxbtsejwtnresnswntciglsuirhsmvlfzrrlabthoujejiytngxuofsrfhnno

ffmvghpiidefthiesanyltrjwrnlltsqrtheelcsigepweeslgfolrnoaefcjawlruifczrvvxuezncqkbawowllrglmvsvfeyaczei

eoodarntpdkzmfftxkmvriynfjxulznugrrvprjarpedoljgrbmcjhsetd


Show all your steps including:
? The Kasiski’s test
? Hypotheses of the probable period(s) and their assessment using index of coincidence calculations.
? Using correlation function<


a) (5pts) Perform a frequency analysis on the ciphertext and plot a figure that looks like the one shown below (this is slide 12 in CH02.pptx). How do both plots relate to one another?

b) (5pts) Kasiski’s test


Related Discussions:- Cracking the Vigenere Cipher

Growth of lan technology, GROWTH OF LAN TECHNOLOGY The production of s...

GROWTH OF LAN TECHNOLOGY The production of shared communication channels (LANs) started in 1960s and early 1970. The basic idea behind was to reduce the number of connectio

Explain the concept of zero knowledge proofs, (a) Describe the concept of ...

(a) Describe the concept of zero knowledge proofs. Give a practical example. (b) Explain how a one way hash function works. (c) What are message authentication codes? (d)

CNSS, Assume that a security model is needed for the protection of informat...

Assume that a security model is needed for the protection of information in your class. Using the CNSS model, examine each of the cells and write a brief statement on how you would

Analysis phase in the building-block approach, QUESTION: a) Explain fou...

QUESTION: a) Explain four issues that are generally addressed in the Needs Analysis phase in the building-block approach to network design. b) Sketch a typical hybrid star-b

Define checksum, The method used to check errors is checksum . In this m...

The method used to check errors is checksum . In this method data is treated as a sequence of integers and their arithmetic sum is calculated and the carry bits are added to the

Data classification and management, Data Classification and Management C...

Data Classification and Management Corporate and military organizations use a several of classification schemes. Information owners are responsible for classifying information a

Securities Issues in a company, 'Near Field Communication' (NFC) technologi...

'Near Field Communication' (NFC) technologies are expected to become commonplace in the near future. Some relevant features are these: A suitable device (such as a mobile pho

Question, Describe the process a proposed standard goes through to become a...

Describe the process a proposed standard goes through to become an RFC

Describe the procedure known as byte stuffing, Question: (a) For the b...

Question: (a) For the bit stream 010011, sketch the waveforms for each of the code indicated. Assume the following: the signal level for the previous bit for NRZI was a 1

Arp responses, ARP RESPONSES Let's search out how does a computer know...

ARP RESPONSES Let's search out how does a computer know whether an incoming frame have an ARP message. The type field in the frame header defines that the frame contain an ARP

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd