Cracking the Vigenere Cipher, Computer Network Security

Assignment Help:

The following message was enciphered with a Vigenère cipher.

aikiaawgfspxeppvjabjnivulfznzvkrlidamsmyamlvskniyffdpbwtnxsvvbtnamvltsefoeycztkomylmerkwrs

deusjgecmzkwvnreeypnnosdahjepkujejwttymoeatnvtipafsvgjnvtrlkauiwertshdtasqmfaooltxjiehrzmcpcosdiz

szukzezpeoehevrrajlsarlmzjimayddscnyzsyahnczucvqnkptywmedpbllwqedpzliuagieysaljtismaeowzllghpiifijt

padeegedszfgrtsuikhnyrucqhbpcaugqnymeujscppdrxxrrehzkarevauemgttnxvvvnvdiazvnrwyaprdlneqjbxsaj

gzrrnodwetrziearwucydsxpharvnmrwdolllnmatffweeeuifxbtsegjiziprcwetuphrkwreytywqghconfmaaetywhreae

evavtsbfllzaycywwgecccmffaydeganrdeespseltljmagtnkzivrqiikxsofrdsxphpsffxueqiolyeewijlwbpprystfiesegw

hrarzkighltkzivrqiikxrvprkjmctztywizicakwwpoxejomghehvewgiwlcgsxiygwgvghpiixmesepfargszfkzifelsffwniyt

jsvrtseffpltpadarghppiwqveclvskhejeklsteeowxxuexaiceadehvjinrppcwrgyzfjlegslrfmrqsfgxwwgiyggjszoeeulin

mdwygpbsptywmeftrjlxurpexsqrslrvvsbmpdfxgbucsvllryweuskniysktsghnikqeadfnzliqsnoiartthitwmaelcyyeze

ehvzszeoewwegtztygwrthocsxrrzbzfznnaeikmrgzackjbrfnzliqmfskzeiemevftnreitmpnrwyxspyiygrfhghptnwrgy

oewwegbjwzyeaaeskeeeydijhvrctsvdcghpsfjxbfcejmpgtsepzeieeornsvdtfkzilrptfymieehvewrlgejshrcpnkuln

nnefxwgajieyycacsvfeywprvaqcrpsjazrllsklmzezukarntheelcjiyakdmiecpfgpjiehcmonsaougpfktaevwnneits

dbrwajuseiygkzivrqiikxtolljxsetsetdyotsepoieelljgeespnrdwsicskysnldowllrspajgrzodtcqqvsqiiartaeoewiad

ehvyyanprjzeiemevfwbltdrlxueztywvrnoowllrptttzxurpetdinndhvwxfiyaigazavejaxghpccmffbpskkxnretfswra

doeviseyszniyyqoiwmtheyvakutjerjwghpymwrrvprxgrrfzuiyezedwzllbuecffgrdtnxsxghpsksvgoqajwefoyiellrtz

puazvstoesrqielctivneeiwwgiygkgwretfcswgspajgrftzpjuseecszfxuenhretvoysyatrirhkqjvvpcrfxeofbcwxuexhv

jinfeeizeiiygjgqrsfctwwfarazfwgtsedsrphpskwvplfbjaxfbpeesauiwejarpeehvkigwzccmffllskeigiytywpraruvwzv

dpntwhoyehvxeptehrlwbuehretgoyscswgvtszlxbtsejwtnresnswntciglsuirhsmvlfzrrlabthoujejiytngxuofsrfhnno

ffmvghpiidefthiesanyltrjwrnlltsqrtheelcsigepweeslgfolrnoaefcjawlruifczrvvxuezncqkbawowllrglmvsvfeyaczei

eoodarntpdkzmfftxkmvriynfjxulznugrrvprjarpedoljgrbmcjhsetd


Show all your steps including:
? The Kasiski’s test
? Hypotheses of the probable period(s) and their assessment using index of coincidence calculations.
? Using correlation function<


a) (5pts) Perform a frequency analysis on the ciphertext and plot a figure that looks like the one shown below (this is slide 12 in CH02.pptx). How do both plots relate to one another?

b) (5pts) Kasiski’s test


Related Discussions:- Cracking the Vigenere Cipher

What is b-router, B-Router Hybrid devices that has the features of bot...

B-Router Hybrid devices that has the features of both routers and bridges . A bridge router or brouter is a network machine that acts as a router and as a bridge. The brout

Spambot detection - spam mail, Spambot Detection: The  previous studie...

Spambot Detection: The  previous studies in this field  have focused on content and meta-content based features.  The main assumption in this area of spam detection of late is

Venn Diagram Problem, Students were asked about search engine they used.90 ...

Students were asked about search engine they used.90 of them said they used google chrome,70 used Internet Explorer,40 used Mozilla Firefox,30 used Google Chrome and Internet Explo

Draw the network layout, Question : a) Below is a capture of an Etherne...

Question : a) Below is a capture of an Ethernet II frame which contains an IPv4 packet and a TCP segment. Give the source MAC address for the frame in hexadecimal; the source I

Define byte stuffing, Sometimes the special character may see in data and a...

Sometimes the special character may see in data and as a part of data they will be misinterpreted as packet data. The solution to this cause is Byte stuffing.   In general to

Direct sequence modulation, Question 1 a) Provide three advantages of ...

Question 1 a) Provide three advantages of using optical fiber. b) Distinguish between "Direct Sequence Modulation" and "Frequency Hopping" c) Decribe the purpose of using "

Draw the full network diagram, Problem (a) Below is a capture of an E...

Problem (a) Below is a capture of an Ethernet II frame which contains an IPv4 packet and a TCP segment. The second screen capture is from the data portion of the frame.

Ipv6 base header format, IPV6 BASE HEADER FORMAT: It has less informat...

IPV6 BASE HEADER FORMAT: It has less information than IPV4 message header. Next header shows to first extension message header. Flow label is partitioned into a TRAFFIC CLASS

Identify possible controls-information security, Identify Possible Controls...

Identify Possible Controls For each threat and linked vulnerabilities which have residual risk, create primary list of control ideas. Residual risk is the risk which remains to

Potential risks to information systems, Information System Security 1. ...

Information System Security 1. Write about: a. Potential Risks to Information Systems b. Factors to be addressed for making information systems more secure 2. Write about t

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd