Cracking the Vigenere Cipher, Computer Network Security

Assignment Help:

The following message was enciphered with a Vigenère cipher.

aikiaawgfspxeppvjabjnivulfznzvkrlidamsmyamlvskniyffdpbwtnxsvvbtnamvltsefoeycztkomylmerkwrs

deusjgecmzkwvnreeypnnosdahjepkujejwttymoeatnvtipafsvgjnvtrlkauiwertshdtasqmfaooltxjiehrzmcpcosdiz

szukzezpeoehevrrajlsarlmzjimayddscnyzsyahnczucvqnkptywmedpbllwqedpzliuagieysaljtismaeowzllghpiifijt

padeegedszfgrtsuikhnyrucqhbpcaugqnymeujscppdrxxrrehzkarevauemgttnxvvvnvdiazvnrwyaprdlneqjbxsaj

gzrrnodwetrziearwucydsxpharvnmrwdolllnmatffweeeuifxbtsegjiziprcwetuphrkwreytywqghconfmaaetywhreae

evavtsbfllzaycywwgecccmffaydeganrdeespseltljmagtnkzivrqiikxsofrdsxphpsffxueqiolyeewijlwbpprystfiesegw

hrarzkighltkzivrqiikxrvprkjmctztywizicakwwpoxejomghehvewgiwlcgsxiygwgvghpiixmesepfargszfkzifelsffwniyt

jsvrtseffpltpadarghppiwqveclvskhejeklsteeowxxuexaiceadehvjinrppcwrgyzfjlegslrfmrqsfgxwwgiyggjszoeeulin

mdwygpbsptywmeftrjlxurpexsqrslrvvsbmpdfxgbucsvllryweuskniysktsghnikqeadfnzliqsnoiartthitwmaelcyyeze

ehvzszeoewwegtztygwrthocsxrrzbzfznnaeikmrgzackjbrfnzliqmfskzeiemevftnreitmpnrwyxspyiygrfhghptnwrgy

oewwegbjwzyeaaeskeeeydijhvrctsvdcghpsfjxbfcejmpgtsepzeieeornsvdtfkzilrptfymieehvewrlgejshrcpnkuln

nnefxwgajieyycacsvfeywprvaqcrpsjazrllsklmzezukarntheelcjiyakdmiecpfgpjiehcmonsaougpfktaevwnneits

dbrwajuseiygkzivrqiikxtolljxsetsetdyotsepoieelljgeespnrdwsicskysnldowllrspajgrzodtcqqvsqiiartaeoewiad

ehvyyanprjzeiemevfwbltdrlxueztywvrnoowllrptttzxurpetdinndhvwxfiyaigazavejaxghpccmffbpskkxnretfswra

doeviseyszniyyqoiwmtheyvakutjerjwghpymwrrvprxgrrfzuiyezedwzllbuecffgrdtnxsxghpsksvgoqajwefoyiellrtz

puazvstoesrqielctivneeiwwgiygkgwretfcswgspajgrftzpjuseecszfxuenhretvoysyatrirhkqjvvpcrfxeofbcwxuexhv

jinfeeizeiiygjgqrsfctwwfarazfwgtsedsrphpskwvplfbjaxfbpeesauiwejarpeehvkigwzccmffllskeigiytywpraruvwzv

dpntwhoyehvxeptehrlwbuehretgoyscswgvtszlxbtsejwtnresnswntciglsuirhsmvlfzrrlabthoujejiytngxuofsrfhnno

ffmvghpiidefthiesanyltrjwrnlltsqrtheelcsigepweeslgfolrnoaefcjawlruifczrvvxuezncqkbawowllrglmvsvfeyaczei

eoodarntpdkzmfftxkmvriynfjxulznugrrvprjarpedoljgrbmcjhsetd


Show all your steps including:
? The Kasiski’s test
? Hypotheses of the probable period(s) and their assessment using index of coincidence calculations.
? Using correlation function<


a) (5pts) Perform a frequency analysis on the ciphertext and plot a figure that looks like the one shown below (this is slide 12 in CH02.pptx). How do both plots relate to one another?

b) (5pts) Kasiski’s test


Related Discussions:- Cracking the Vigenere Cipher

Differences between a hacker and a cracker, Question: (a) Which of the...

Question: (a) Which of the following is not a goal of security: i) detection ii) prevention iii) recovery iv) prosecution (b) You are an honest student. One day you

Write a note on digital signature, Question 1 Explain the types of threats...

Question 1 Explain the types of threats (Attacks) Question 2 What are the Characteristics of Good Encryption Technique? Question 3 Write a note on Digital Signatur

CNSS, Assume that a security model is needed for the protection of informat...

Assume that a security model is needed for the protection of information in your class. Using the CNSS model, examine each of the cells and write a brief statement on how you would

Direct sequence modulation, Question 1 a) Provide three advantages of ...

Question 1 a) Provide three advantages of using optical fiber. b) Distinguish between "Direct Sequence Modulation" and "Frequency Hopping" c) Decribe the purpose of using "

Illustrate the label switching procedure in an mpls network, QUESTION ...

QUESTION a) Explain the terms traffic engineering, class-based queuing, shaping and grooming in an MPLS network. b) Using an example topology, illustrate the label swi

Address resolution with message exchange, ADDRESS RESOLUTION WITH MESSAGE E...

ADDRESS RESOLUTION WITH MESSAGE EXCHANGE An alternative to local calculation is a distributed function. A computer that requires to find an address transmits a message across

Extended euclidean algorithm, (a) Using the extended Euclidean algorithm, ...

(a) Using the extended Euclidean algorithm, find the multiplicative inverse of 504 mod 67. (b) Decrypt the following ciphertext, which has been encrypted using Caesar cipher:

Ids deployment overview, IDS Deployment Overview The decision regarding ...

IDS Deployment Overview The decision regarding control strategies, decisions about where to locate elements of intrusion detection systems is an art in itself. Planners should s

Area subdivision, the advantages and disadvantages of area subdivision and ...

the advantages and disadvantages of area subdivision and where it is applicable

Calculate alpha and beta value caesar cipher, Task 1 a. Consider the t...

Task 1 a. Consider the table showing the relative frequencies of letters in English. Arrange the frequencies from largest to smallest, and make a cumulative plot, using Exc

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd