Cracking the Vigenere Cipher, Computer Network Security

Assignment Help:

The following message was enciphered with a Vigenère cipher.

aikiaawgfspxeppvjabjnivulfznzvkrlidamsmyamlvskniyffdpbwtnxsvvbtnamvltsefoeycztkomylmerkwrs

deusjgecmzkwvnreeypnnosdahjepkujejwttymoeatnvtipafsvgjnvtrlkauiwertshdtasqmfaooltxjiehrzmcpcosdiz

szukzezpeoehevrrajlsarlmzjimayddscnyzsyahnczucvqnkptywmedpbllwqedpzliuagieysaljtismaeowzllghpiifijt

padeegedszfgrtsuikhnyrucqhbpcaugqnymeujscppdrxxrrehzkarevauemgttnxvvvnvdiazvnrwyaprdlneqjbxsaj

gzrrnodwetrziearwucydsxpharvnmrwdolllnmatffweeeuifxbtsegjiziprcwetuphrkwreytywqghconfmaaetywhreae

evavtsbfllzaycywwgecccmffaydeganrdeespseltljmagtnkzivrqiikxsofrdsxphpsffxueqiolyeewijlwbpprystfiesegw

hrarzkighltkzivrqiikxrvprkjmctztywizicakwwpoxejomghehvewgiwlcgsxiygwgvghpiixmesepfargszfkzifelsffwniyt

jsvrtseffpltpadarghppiwqveclvskhejeklsteeowxxuexaiceadehvjinrppcwrgyzfjlegslrfmrqsfgxwwgiyggjszoeeulin

mdwygpbsptywmeftrjlxurpexsqrslrvvsbmpdfxgbucsvllryweuskniysktsghnikqeadfnzliqsnoiartthitwmaelcyyeze

ehvzszeoewwegtztygwrthocsxrrzbzfznnaeikmrgzackjbrfnzliqmfskzeiemevftnreitmpnrwyxspyiygrfhghptnwrgy

oewwegbjwzyeaaeskeeeydijhvrctsvdcghpsfjxbfcejmpgtsepzeieeornsvdtfkzilrptfymieehvewrlgejshrcpnkuln

nnefxwgajieyycacsvfeywprvaqcrpsjazrllsklmzezukarntheelcjiyakdmiecpfgpjiehcmonsaougpfktaevwnneits

dbrwajuseiygkzivrqiikxtolljxsetsetdyotsepoieelljgeespnrdwsicskysnldowllrspajgrzodtcqqvsqiiartaeoewiad

ehvyyanprjzeiemevfwbltdrlxueztywvrnoowllrptttzxurpetdinndhvwxfiyaigazavejaxghpccmffbpskkxnretfswra

doeviseyszniyyqoiwmtheyvakutjerjwghpymwrrvprxgrrfzuiyezedwzllbuecffgrdtnxsxghpsksvgoqajwefoyiellrtz

puazvstoesrqielctivneeiwwgiygkgwretfcswgspajgrftzpjuseecszfxuenhretvoysyatrirhkqjvvpcrfxeofbcwxuexhv

jinfeeizeiiygjgqrsfctwwfarazfwgtsedsrphpskwvplfbjaxfbpeesauiwejarpeehvkigwzccmffllskeigiytywpraruvwzv

dpntwhoyehvxeptehrlwbuehretgoyscswgvtszlxbtsejwtnresnswntciglsuirhsmvlfzrrlabthoujejiytngxuofsrfhnno

ffmvghpiidefthiesanyltrjwrnlltsqrtheelcsigepweeslgfolrnoaefcjawlruifczrvvxuezncqkbawowllrglmvsvfeyaczei

eoodarntpdkzmfftxkmvriynfjxulznugrrvprjarpedoljgrbmcjhsetd


Show all your steps including:
? The Kasiski’s test
? Hypotheses of the probable period(s) and their assessment using index of coincidence calculations.
? Using correlation function<


a) (5pts) Perform a frequency analysis on the ciphertext and plot a figure that looks like the one shown below (this is slide 12 in CH02.pptx). How do both plots relate to one another?

b) (5pts) Kasiski’s test


Related Discussions:- Cracking the Vigenere Cipher

Why is this setup not secure, Question: a) You are using Active Directo...

Question: a) You are using Active Directory Users under Windows Server 2003 and Computers to configure user objects in your domain, and you are able to change the address and

Define half-duplex, A  half-duplex (HDX) system gives communication in b...

A  half-duplex (HDX) system gives communication in both directions, but only one direction at a time. Hardly, once a party stats receiving a signal, it must need for the transmi

Briefly explain the contents of the needs analysis, QUESTION (a) Brief...

QUESTION (a) Briefly explain the contents of the Needs Analysis, which is step in the process of network design. (b) Describe on the three ways of improving the performan

Systems-specific policy (syssp), Systems-Specific Policy (SysSP) SysSP...

Systems-Specific Policy (SysSP) SysSPs are codified as standards and procedures which are used when configuring or maintaining systems. Systems specific policies fall into 2 g

Describe des encryption, (a) Describe DES encryption with a block diagram a...

(a) Describe DES encryption with a block diagram and brief steps. (b) How does triple DES improve security. What is the effective key length of triple DES? How can 3DES be compa

Nessus vulnerability, You see two IP addresses. The IP address 192.168.58.1...

You see two IP addresses. The IP address 192.168.58.130 is the one of Bt4. The IP address 192.168.58.133 has ports 135 and 445 open; which indicates that it is a Windows machine. S

Attacks on cryptosystems-cryptography, Attacks on Cryptosystems Attacks a...

Attacks on Cryptosystems Attacks are attempts to achieve unauthorized access to secure communications have characteristically used brute force attacks. Attacker may alternatively

TCP/ ip, Q1 (15 marks, 5 marks each part): This question has three parts: ...

Q1 (15 marks, 5 marks each part): This question has three parts: In a short paragraph (200-300 words) explain the fundamentals of Packet Switching and how it works. In a short pa

Simplex data exchange, Simplex data exchange Simplex communication def...

Simplex data exchange Simplex communication defines to communication that happens in one direction only. Two definitions have made over time: a common definition, which is des

Explain how the diffie-hellman key agreement protocol works, (a) Using Fer...

(a) Using Fermat's theorem, find 3 201 mod 11. (b) Explain how the Diffie-Hellman key agreement protocol works and what its purpose and main properties are. Consider a Dif

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd