Cracking the Vigenere Cipher, Computer Network Security

Assignment Help:

The following message was enciphered with a Vigenère cipher.

aikiaawgfspxeppvjabjnivulfznzvkrlidamsmyamlvskniyffdpbwtnxsvvbtnamvltsefoeycztkomylmerkwrs

deusjgecmzkwvnreeypnnosdahjepkujejwttymoeatnvtipafsvgjnvtrlkauiwertshdtasqmfaooltxjiehrzmcpcosdiz

szukzezpeoehevrrajlsarlmzjimayddscnyzsyahnczucvqnkptywmedpbllwqedpzliuagieysaljtismaeowzllghpiifijt

padeegedszfgrtsuikhnyrucqhbpcaugqnymeujscppdrxxrrehzkarevauemgttnxvvvnvdiazvnrwyaprdlneqjbxsaj

gzrrnodwetrziearwucydsxpharvnmrwdolllnmatffweeeuifxbtsegjiziprcwetuphrkwreytywqghconfmaaetywhreae

evavtsbfllzaycywwgecccmffaydeganrdeespseltljmagtnkzivrqiikxsofrdsxphpsffxueqiolyeewijlwbpprystfiesegw

hrarzkighltkzivrqiikxrvprkjmctztywizicakwwpoxejomghehvewgiwlcgsxiygwgvghpiixmesepfargszfkzifelsffwniyt

jsvrtseffpltpadarghppiwqveclvskhejeklsteeowxxuexaiceadehvjinrppcwrgyzfjlegslrfmrqsfgxwwgiyggjszoeeulin

mdwygpbsptywmeftrjlxurpexsqrslrvvsbmpdfxgbucsvllryweuskniysktsghnikqeadfnzliqsnoiartthitwmaelcyyeze

ehvzszeoewwegtztygwrthocsxrrzbzfznnaeikmrgzackjbrfnzliqmfskzeiemevftnreitmpnrwyxspyiygrfhghptnwrgy

oewwegbjwzyeaaeskeeeydijhvrctsvdcghpsfjxbfcejmpgtsepzeieeornsvdtfkzilrptfymieehvewrlgejshrcpnkuln

nnefxwgajieyycacsvfeywprvaqcrpsjazrllsklmzezukarntheelcjiyakdmiecpfgpjiehcmonsaougpfktaevwnneits

dbrwajuseiygkzivrqiikxtolljxsetsetdyotsepoieelljgeespnrdwsicskysnldowllrspajgrzodtcqqvsqiiartaeoewiad

ehvyyanprjzeiemevfwbltdrlxueztywvrnoowllrptttzxurpetdinndhvwxfiyaigazavejaxghpccmffbpskkxnretfswra

doeviseyszniyyqoiwmtheyvakutjerjwghpymwrrvprxgrrfzuiyezedwzllbuecffgrdtnxsxghpsksvgoqajwefoyiellrtz

puazvstoesrqielctivneeiwwgiygkgwretfcswgspajgrftzpjuseecszfxuenhretvoysyatrirhkqjvvpcrfxeofbcwxuexhv

jinfeeizeiiygjgqrsfctwwfarazfwgtsedsrphpskwvplfbjaxfbpeesauiwejarpeehvkigwzccmffllskeigiytywpraruvwzv

dpntwhoyehvxeptehrlwbuehretgoyscswgvtszlxbtsejwtnresnswntciglsuirhsmvlfzrrlabthoujejiytngxuofsrfhnno

ffmvghpiidefthiesanyltrjwrnlltsqrtheelcsigepweeslgfolrnoaefcjawlruifczrvvxuezncqkbawowllrglmvsvfeyaczei

eoodarntpdkzmfftxkmvriynfjxulznugrrvprjarpedoljgrbmcjhsetd


Show all your steps including:
? The Kasiski’s test
? Hypotheses of the probable period(s) and their assessment using index of coincidence calculations.
? Using correlation function<


a) (5pts) Perform a frequency analysis on the ciphertext and plot a figure that looks like the one shown below (this is slide 12 in CH02.pptx). How do both plots relate to one another?

b) (5pts) Kasiski’s test


Related Discussions:- Cracking the Vigenere Cipher

Find the possible deciphering transformations, Question: (a) A string o...

Question: (a) A string of ciphertext was enciphered using an a±ne transformation of single letters in a 28-letter alphabet consisting of A to Z, a blank and a?, where A to Z ha

Encryption key size-cryptography, Encryption Key Size When using ciphers...

Encryption Key Size When using ciphers, the size of crypto variable or key is quite important as the strength of many encryption applications and cryptosystems were measured by

Risk control strategies-, Risk Control Strategies Once the ranked vulner...

Risk Control Strategies Once the ranked vulnerability risk worksheet has created, they should choose one of following 4 strategies to control each risk: •Apply safeguards which

How to create a security policy, Five years ago, Calgary Kids' Cloth Ltd wa...

Five years ago, Calgary Kids' Cloth Ltd was just a small retail store in downtown Calgary. The company started their own factory in SE Calgary to produce outdoor clothes for kids.

Describe des encryption, (a) Describe DES encryption with a block diagram a...

(a) Describe DES encryption with a block diagram and brief steps. (b) How does triple DES improve security. What is the effective key length of triple DES? How can 3DES be compa

Cryptographic algorithms-cryptography, Cryptographic algorithms Cryptogr...

Cryptographic algorithms Cryptographic algorithms are broadly classified into two broad categories. They are stated below 1.  Symmetric Encryption and 2.  Asymmetric Encryptio

Calculate the false rejection, Divide the user data into 6 equal sets. Use ...

Divide the user data into 6 equal sets. Use the first set for the enrollment phase of your system, and the rest for the verification phase. Use the following formula to calculate t

Social network development in java , Social Network development in Java: ...

Social Network development in Java: Project Title: SUGGESTLOCAL (Nov 2006-April 2007) Role             : Developer Domain        : Social Network Client          :

Programming, SDES encryption and decryption

SDES encryption and decryption

Address resolution techniques, Address resolution algorithms may be grouped...

Address resolution algorithms may be grouped into three basic types: Table lookup Closed-form computation Message Exchange 1. TABLE LOOKUP: In Table Loo

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd