Cracking the Vigenere Cipher, Computer Network Security

Assignment Help:

The following message was enciphered with a Vigenère cipher.

aikiaawgfspxeppvjabjnivulfznzvkrlidamsmyamlvskniyffdpbwtnxsvvbtnamvltsefoeycztkomylmerkwrs

deusjgecmzkwvnreeypnnosdahjepkujejwttymoeatnvtipafsvgjnvtrlkauiwertshdtasqmfaooltxjiehrzmcpcosdiz

szukzezpeoehevrrajlsarlmzjimayddscnyzsyahnczucvqnkptywmedpbllwqedpzliuagieysaljtismaeowzllghpiifijt

padeegedszfgrtsuikhnyrucqhbpcaugqnymeujscppdrxxrrehzkarevauemgttnxvvvnvdiazvnrwyaprdlneqjbxsaj

gzrrnodwetrziearwucydsxpharvnmrwdolllnmatffweeeuifxbtsegjiziprcwetuphrkwreytywqghconfmaaetywhreae

evavtsbfllzaycywwgecccmffaydeganrdeespseltljmagtnkzivrqiikxsofrdsxphpsffxueqiolyeewijlwbpprystfiesegw

hrarzkighltkzivrqiikxrvprkjmctztywizicakwwpoxejomghehvewgiwlcgsxiygwgvghpiixmesepfargszfkzifelsffwniyt

jsvrtseffpltpadarghppiwqveclvskhejeklsteeowxxuexaiceadehvjinrppcwrgyzfjlegslrfmrqsfgxwwgiyggjszoeeulin

mdwygpbsptywmeftrjlxurpexsqrslrvvsbmpdfxgbucsvllryweuskniysktsghnikqeadfnzliqsnoiartthitwmaelcyyeze

ehvzszeoewwegtztygwrthocsxrrzbzfznnaeikmrgzackjbrfnzliqmfskzeiemevftnreitmpnrwyxspyiygrfhghptnwrgy

oewwegbjwzyeaaeskeeeydijhvrctsvdcghpsfjxbfcejmpgtsepzeieeornsvdtfkzilrptfymieehvewrlgejshrcpnkuln

nnefxwgajieyycacsvfeywprvaqcrpsjazrllsklmzezukarntheelcjiyakdmiecpfgpjiehcmonsaougpfktaevwnneits

dbrwajuseiygkzivrqiikxtolljxsetsetdyotsepoieelljgeespnrdwsicskysnldowllrspajgrzodtcqqvsqiiartaeoewiad

ehvyyanprjzeiemevfwbltdrlxueztywvrnoowllrptttzxurpetdinndhvwxfiyaigazavejaxghpccmffbpskkxnretfswra

doeviseyszniyyqoiwmtheyvakutjerjwghpymwrrvprxgrrfzuiyezedwzllbuecffgrdtnxsxghpsksvgoqajwefoyiellrtz

puazvstoesrqielctivneeiwwgiygkgwretfcswgspajgrftzpjuseecszfxuenhretvoysyatrirhkqjvvpcrfxeofbcwxuexhv

jinfeeizeiiygjgqrsfctwwfarazfwgtsedsrphpskwvplfbjaxfbpeesauiwejarpeehvkigwzccmffllskeigiytywpraruvwzv

dpntwhoyehvxeptehrlwbuehretgoyscswgvtszlxbtsejwtnresnswntciglsuirhsmvlfzrrlabthoujejiytngxuofsrfhnno

ffmvghpiidefthiesanyltrjwrnlltsqrtheelcsigepweeslgfolrnoaefcjawlruifczrvvxuezncqkbawowllrglmvsvfeyaczei

eoodarntpdkzmfftxkmvriynfjxulznugrrvprjarpedoljgrbmcjhsetd


Show all your steps including:
? The Kasiski’s test
? Hypotheses of the probable period(s) and their assessment using index of coincidence calculations.
? Using correlation function<


a) (5pts) Perform a frequency analysis on the ciphertext and plot a figure that looks like the one shown below (this is slide 12 in CH02.pptx). How do both plots relate to one another?

b) (5pts) Kasiski’s test


Related Discussions:- Cracking the Vigenere Cipher

Mitigate risks in an information security management system, Question: ...

Question: (a) What are the various options to mitigate risks in an Information Security Management System (ISMS)? For each option specify an instance where it can be used.

Fragmentation format, FRAGMENTATION Fragmentation information is kept...

FRAGMENTATION Fragmentation information is kept in different extension header.  Every fragment has base header and fragmentation header. Whole datagram including original hea

The major decision hierarchy for disclosing security problem, QUESTION ...

QUESTION The major decision hierarchy for disclosing security problems is if the problem is with the product owned by the business or if it is used by the business. Although th

Explain how can we achieved privacy in an e-mail system, Explain how can we...

Explain how can we achieved privacy in an e-mail system.  The full form of PEM is Privacy Enhanced Mail: PEM  is  the  internet  Privacy  Enhanced  Mail  standard  adopted

Potential risks to information systems, Information System Security 1. ...

Information System Security 1. Write about: a. Potential Risks to Information Systems b. Factors to be addressed for making information systems more secure 2. Write about t

Explain how the framework will align to the model, MB Enterprise Systems Lt...

MB Enterprise Systems Ltd based in Mauritius is a company specialized in application development with Europe as the main customer base. The company has implemented CMMI and has rec

Meaning of dns - domain name system, What do you understand by the DNS? Exp...

What do you understand by the DNS? Explain the usage of the resource rec or ds. Domain Name System is described below: The Domain Name Service (DNS) is the hierarchi

Explain what is software debouncing, Question : (a) How does a 2-key r...

Question : (a) How does a 2-key rollover differ from the N-key rollover? (b) Why is isolation so important in interfacing? (c) Explain what is software debouncing.

Trap and trace systems-information security, TRAP AND TRACE SYSTEMS Trap...

TRAP AND TRACE SYSTEMS Trap and Trace Systems use techniques to detect an intrusion and trace it back to its source. Trap comprises of honey pot or padded cell and alarm. The dr

Internet protocol (ipv6), SUCCESS OF IP:  IP has accommodated dramatic...

SUCCESS OF IP:  IP has accommodated dramatic modification since real design. But basic rules are still appropriate today. There are many new kinds of hardware. SCALING:

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd