Cracking the Vigenere Cipher, Computer Network Security

Assignment Help:

The following message was enciphered with a Vigenère cipher.

aikiaawgfspxeppvjabjnivulfznzvkrlidamsmyamlvskniyffdpbwtnxsvvbtnamvltsefoeycztkomylmerkwrs

deusjgecmzkwvnreeypnnosdahjepkujejwttymoeatnvtipafsvgjnvtrlkauiwertshdtasqmfaooltxjiehrzmcpcosdiz

szukzezpeoehevrrajlsarlmzjimayddscnyzsyahnczucvqnkptywmedpbllwqedpzliuagieysaljtismaeowzllghpiifijt

padeegedszfgrtsuikhnyrucqhbpcaugqnymeujscppdrxxrrehzkarevauemgttnxvvvnvdiazvnrwyaprdlneqjbxsaj

gzrrnodwetrziearwucydsxpharvnmrwdolllnmatffweeeuifxbtsegjiziprcwetuphrkwreytywqghconfmaaetywhreae

evavtsbfllzaycywwgecccmffaydeganrdeespseltljmagtnkzivrqiikxsofrdsxphpsffxueqiolyeewijlwbpprystfiesegw

hrarzkighltkzivrqiikxrvprkjmctztywizicakwwpoxejomghehvewgiwlcgsxiygwgvghpiixmesepfargszfkzifelsffwniyt

jsvrtseffpltpadarghppiwqveclvskhejeklsteeowxxuexaiceadehvjinrppcwrgyzfjlegslrfmrqsfgxwwgiyggjszoeeulin

mdwygpbsptywmeftrjlxurpexsqrslrvvsbmpdfxgbucsvllryweuskniysktsghnikqeadfnzliqsnoiartthitwmaelcyyeze

ehvzszeoewwegtztygwrthocsxrrzbzfznnaeikmrgzackjbrfnzliqmfskzeiemevftnreitmpnrwyxspyiygrfhghptnwrgy

oewwegbjwzyeaaeskeeeydijhvrctsvdcghpsfjxbfcejmpgtsepzeieeornsvdtfkzilrptfymieehvewrlgejshrcpnkuln

nnefxwgajieyycacsvfeywprvaqcrpsjazrllsklmzezukarntheelcjiyakdmiecpfgpjiehcmonsaougpfktaevwnneits

dbrwajuseiygkzivrqiikxtolljxsetsetdyotsepoieelljgeespnrdwsicskysnldowllrspajgrzodtcqqvsqiiartaeoewiad

ehvyyanprjzeiemevfwbltdrlxueztywvrnoowllrptttzxurpetdinndhvwxfiyaigazavejaxghpccmffbpskkxnretfswra

doeviseyszniyyqoiwmtheyvakutjerjwghpymwrrvprxgrrfzuiyezedwzllbuecffgrdtnxsxghpsksvgoqajwefoyiellrtz

puazvstoesrqielctivneeiwwgiygkgwretfcswgspajgrftzpjuseecszfxuenhretvoysyatrirhkqjvvpcrfxeofbcwxuexhv

jinfeeizeiiygjgqrsfctwwfarazfwgtsedsrphpskwvplfbjaxfbpeesauiwejarpeehvkigwzccmffllskeigiytywpraruvwzv

dpntwhoyehvxeptehrlwbuehretgoyscswgvtszlxbtsejwtnresnswntciglsuirhsmvlfzrrlabthoujejiytngxuofsrfhnno

ffmvghpiidefthiesanyltrjwrnlltsqrtheelcsigepweeslgfolrnoaefcjawlruifczrvvxuezncqkbawowllrglmvsvfeyaczei

eoodarntpdkzmfftxkmvriynfjxulznugrrvprjarpedoljgrbmcjhsetd


Show all your steps including:
? The Kasiski’s test
? Hypotheses of the probable period(s) and their assessment using index of coincidence calculations.
? Using correlation function<


a) (5pts) Perform a frequency analysis on the ciphertext and plot a figure that looks like the one shown below (this is slide 12 in CH02.pptx). How do both plots relate to one another?

b) (5pts) Kasiski’s test


Related Discussions:- Cracking the Vigenere Cipher

Ethical hacking penetration testing, Get a copy of Metasploitable at Make...

Get a copy of Metasploitable at Make">http://sourceforge.net/projects/metasploitable/files/Metasploitable2/ Make sure to follow these directions very carefully. You will get po

Social studies, how would land elevation have canged if coronado had travel...

how would land elevation have canged if coronado had traveled 150 miles due west from what is today arizona instead of west toward new mexico

Cryptographic hash functions, (a) (i) Bob has public RSA key (n = 77, e...

(a) (i) Bob has public RSA key (n = 77, e = 7). Show that Bob's private key is (d = 43). (ii) Alice wants to send the message m = 13 to Bob. She encrypts the message usi

Illustrate about tinysec protocol, Illustrate about TinySec Protocol T...

Illustrate about TinySec Protocol TinySec is implemented on the link layer and addresses security requirements of the resource staffed nodes in the WSN based on the link layer

Explain what is software debouncing, Question : (a) How does a 2-key r...

Question : (a) How does a 2-key rollover differ from the N-key rollover? (b) Why is isolation so important in interfacing? (c) Explain what is software debouncing.

Why is this setup not secure, Question: a) You are using Active Directo...

Question: a) You are using Active Directory Users under Windows Server 2003 and Computers to configure user objects in your domain, and you are able to change the address and

Define repeater, Repeater known as regenerator ; it is an electronic mac...

Repeater known as regenerator ; it is an electronic machine that performs only at physical layer. It gets the signal in the network before it becomes loss or weak, recreates the

Trap and trace systems-information security, TRAP AND TRACE SYSTEMS Trap...

TRAP AND TRACE SYSTEMS Trap and Trace Systems use techniques to detect an intrusion and trace it back to its source. Trap comprises of honey pot or padded cell and alarm. The dr

Location to e-mail messages are saved, In the e-mail system, where the e-ma...

In the e-mail system, where the e-mail messages are saved and why? E-mail messages are saved in user’s private electronic mailbox. A mailbox refers to a local/domestic hard drive c

Udp encapsulation, UDP ENCAPSULATION As given in the figure below, UDP...

UDP ENCAPSULATION As given in the figure below, UDP packet is included in IP datagram and the IP datagram is then attached in the Frame.

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd