Cracking the Vigenere Cipher, Computer Network Security

Assignment Help:

The following message was enciphered with a Vigenère cipher.

aikiaawgfspxeppvjabjnivulfznzvkrlidamsmyamlvskniyffdpbwtnxsvvbtnamvltsefoeycztkomylmerkwrs

deusjgecmzkwvnreeypnnosdahjepkujejwttymoeatnvtipafsvgjnvtrlkauiwertshdtasqmfaooltxjiehrzmcpcosdiz

szukzezpeoehevrrajlsarlmzjimayddscnyzsyahnczucvqnkptywmedpbllwqedpzliuagieysaljtismaeowzllghpiifijt

padeegedszfgrtsuikhnyrucqhbpcaugqnymeujscppdrxxrrehzkarevauemgttnxvvvnvdiazvnrwyaprdlneqjbxsaj

gzrrnodwetrziearwucydsxpharvnmrwdolllnmatffweeeuifxbtsegjiziprcwetuphrkwreytywqghconfmaaetywhreae

evavtsbfllzaycywwgecccmffaydeganrdeespseltljmagtnkzivrqiikxsofrdsxphpsffxueqiolyeewijlwbpprystfiesegw

hrarzkighltkzivrqiikxrvprkjmctztywizicakwwpoxejomghehvewgiwlcgsxiygwgvghpiixmesepfargszfkzifelsffwniyt

jsvrtseffpltpadarghppiwqveclvskhejeklsteeowxxuexaiceadehvjinrppcwrgyzfjlegslrfmrqsfgxwwgiyggjszoeeulin

mdwygpbsptywmeftrjlxurpexsqrslrvvsbmpdfxgbucsvllryweuskniysktsghnikqeadfnzliqsnoiartthitwmaelcyyeze

ehvzszeoewwegtztygwrthocsxrrzbzfznnaeikmrgzackjbrfnzliqmfskzeiemevftnreitmpnrwyxspyiygrfhghptnwrgy

oewwegbjwzyeaaeskeeeydijhvrctsvdcghpsfjxbfcejmpgtsepzeieeornsvdtfkzilrptfymieehvewrlgejshrcpnkuln

nnefxwgajieyycacsvfeywprvaqcrpsjazrllsklmzezukarntheelcjiyakdmiecpfgpjiehcmonsaougpfktaevwnneits

dbrwajuseiygkzivrqiikxtolljxsetsetdyotsepoieelljgeespnrdwsicskysnldowllrspajgrzodtcqqvsqiiartaeoewiad

ehvyyanprjzeiemevfwbltdrlxueztywvrnoowllrptttzxurpetdinndhvwxfiyaigazavejaxghpccmffbpskkxnretfswra

doeviseyszniyyqoiwmtheyvakutjerjwghpymwrrvprxgrrfzuiyezedwzllbuecffgrdtnxsxghpsksvgoqajwefoyiellrtz

puazvstoesrqielctivneeiwwgiygkgwretfcswgspajgrftzpjuseecszfxuenhretvoysyatrirhkqjvvpcrfxeofbcwxuexhv

jinfeeizeiiygjgqrsfctwwfarazfwgtsedsrphpskwvplfbjaxfbpeesauiwejarpeehvkigwzccmffllskeigiytywpraruvwzv

dpntwhoyehvxeptehrlwbuehretgoyscswgvtszlxbtsejwtnresnswntciglsuirhsmvlfzrrlabthoujejiytngxuofsrfhnno

ffmvghpiidefthiesanyltrjwrnlltsqrtheelcsigepweeslgfolrnoaefcjawlruifczrvvxuezncqkbawowllrglmvsvfeyaczei

eoodarntpdkzmfftxkmvriynfjxulznugrrvprjarpedoljgrbmcjhsetd


Show all your steps including:
? The Kasiski’s test
? Hypotheses of the probable period(s) and their assessment using index of coincidence calculations.
? Using correlation function<


a) (5pts) Perform a frequency analysis on the ciphertext and plot a figure that looks like the one shown below (this is slide 12 in CH02.pptx). How do both plots relate to one another?

b) (5pts) Kasiski’s test


Related Discussions:- Cracking the Vigenere Cipher

define broadcast, In broadcast topology there are further two types 1) ...

In broadcast topology there are further two types 1) SATELLITE\RADIO 2) RING TOPOLOGY In a radio or satellite topology every computers are connected to each other via radio o

Find the capacity of the wcdma, Question: (a) Describe the term interfe...

Question: (a) Describe the term interference in the space, time, frequency, and code domain. (b) Consider a 1 G - AMPS: 824-849 MHz (forward) ; 869-894 MHz (reverse). B

Explain the concept behind digital signature, Question: a) Differenti...

Question: a) Differentiate between ‘Gross Settlement' and ‘Multilateral Net Settlement' providing suitable examples where necessary to support your answer. b) Differentia

Provide a labelled drawing of a standard serial port, Question 1: (a) W...

Question 1: (a) With the help of a diagram show the basic structure of a computer system. (b) Explain as fully as you can each of the parts mentioned above. (c) What are

Distinguish between steganograhy and cryptography, Question: (a) Disti...

Question: (a) Distinguish between Steganograhy and Cryptography. (b) "Playfair cipher is more secure than Monoalphabetic cipher." Justify this statement. (c) Various ap

Securities Issues in a company, 'Near Field Communication' (NFC) technologi...

'Near Field Communication' (NFC) technologies are expected to become commonplace in the near future. Some relevant features are these: A suitable device (such as a mobile pho

Documenting the results of risk assessment, Documenting the Results of Risk...

Documenting the Results of Risk Assessment The goal of this process is to recognize the information assets, list them, and rank according to those most required protection. The

Guided media, Guided Media These are those that give a conduit from on...

Guided Media These are those that give a conduit from one machine to another that add twisted-pair, fiber-optic cable and coaxial cable. A signal traveling along any of these

Estimate the average throughput, Question (a) Estimate the average thr...

Question (a) Estimate the average throughput between two hosts given that the RTT for a 100 bytes ICMP request-reply is 1 millisecond and that for a 1500 bytes is 2 millisecon

Systems development life cycle security-information security, The Role of t...

The Role of the Investigation The first phase, investigation is the most significant. What problem is the system being developed to solve? During investigation phase, objectives

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd