Cracking the Vigenere Cipher, Computer Network Security

Assignment Help:

The following message was enciphered with a Vigenère cipher.

aikiaawgfspxeppvjabjnivulfznzvkrlidamsmyamlvskniyffdpbwtnxsvvbtnamvltsefoeycztkomylmerkwrs

deusjgecmzkwvnreeypnnosdahjepkujejwttymoeatnvtipafsvgjnvtrlkauiwertshdtasqmfaooltxjiehrzmcpcosdiz

szukzezpeoehevrrajlsarlmzjimayddscnyzsyahnczucvqnkptywmedpbllwqedpzliuagieysaljtismaeowzllghpiifijt

padeegedszfgrtsuikhnyrucqhbpcaugqnymeujscppdrxxrrehzkarevauemgttnxvvvnvdiazvnrwyaprdlneqjbxsaj

gzrrnodwetrziearwucydsxpharvnmrwdolllnmatffweeeuifxbtsegjiziprcwetuphrkwreytywqghconfmaaetywhreae

evavtsbfllzaycywwgecccmffaydeganrdeespseltljmagtnkzivrqiikxsofrdsxphpsffxueqiolyeewijlwbpprystfiesegw

hrarzkighltkzivrqiikxrvprkjmctztywizicakwwpoxejomghehvewgiwlcgsxiygwgvghpiixmesepfargszfkzifelsffwniyt

jsvrtseffpltpadarghppiwqveclvskhejeklsteeowxxuexaiceadehvjinrppcwrgyzfjlegslrfmrqsfgxwwgiyggjszoeeulin

mdwygpbsptywmeftrjlxurpexsqrslrvvsbmpdfxgbucsvllryweuskniysktsghnikqeadfnzliqsnoiartthitwmaelcyyeze

ehvzszeoewwegtztygwrthocsxrrzbzfznnaeikmrgzackjbrfnzliqmfskzeiemevftnreitmpnrwyxspyiygrfhghptnwrgy

oewwegbjwzyeaaeskeeeydijhvrctsvdcghpsfjxbfcejmpgtsepzeieeornsvdtfkzilrptfymieehvewrlgejshrcpnkuln

nnefxwgajieyycacsvfeywprvaqcrpsjazrllsklmzezukarntheelcjiyakdmiecpfgpjiehcmonsaougpfktaevwnneits

dbrwajuseiygkzivrqiikxtolljxsetsetdyotsepoieelljgeespnrdwsicskysnldowllrspajgrzodtcqqvsqiiartaeoewiad

ehvyyanprjzeiemevfwbltdrlxueztywvrnoowllrptttzxurpetdinndhvwxfiyaigazavejaxghpccmffbpskkxnretfswra

doeviseyszniyyqoiwmtheyvakutjerjwghpymwrrvprxgrrfzuiyezedwzllbuecffgrdtnxsxghpsksvgoqajwefoyiellrtz

puazvstoesrqielctivneeiwwgiygkgwretfcswgspajgrftzpjuseecszfxuenhretvoysyatrirhkqjvvpcrfxeofbcwxuexhv

jinfeeizeiiygjgqrsfctwwfarazfwgtsedsrphpskwvplfbjaxfbpeesauiwejarpeehvkigwzccmffllskeigiytywpraruvwzv

dpntwhoyehvxeptehrlwbuehretgoyscswgvtszlxbtsejwtnresnswntciglsuirhsmvlfzrrlabthoujejiytngxuofsrfhnno

ffmvghpiidefthiesanyltrjwrnlltsqrtheelcsigepweeslgfolrnoaefcjawlruifczrvvxuezncqkbawowllrglmvsvfeyaczei

eoodarntpdkzmfftxkmvriynfjxulznugrrvprjarpedoljgrbmcjhsetd


Show all your steps including:
? The Kasiski’s test
? Hypotheses of the probable period(s) and their assessment using index of coincidence calculations.
? Using correlation function<


a) (5pts) Perform a frequency analysis on the ciphertext and plot a figure that looks like the one shown below (this is slide 12 in CH02.pptx). How do both plots relate to one another?

b) (5pts) Kasiski’s test


Related Discussions:- Cracking the Vigenere Cipher

Firewall architectures-screened subnet architecture, Screened Subnet Archit...

Screened Subnet Architecture This setup provides an extra security layer to screened host architecture by creating a perimeter subnet which further isolates internal network f

Designing and coding of job search mechanism, Designing and coding of Job s...

Designing and coding of Job search mechanism: Project Title: FREEHIVE (Sep 2005- Nov 2006) Role             : Developer Domain         : Social Network Client

Ucsf medical center case study-information security, Example : UCSF Medical...

Example : UCSF Medical Center In the year 2002, the University of California, San Francisco (UCSF) Medical Center received an email message from someone who claimed to be a doct

Spambot detection - spam mail, Spambot Detection: The  previous studie...

Spambot Detection: The  previous studies in this field  have focused on content and meta-content based features.  The main assumption in this area of spam detection of late is

Differentiate between private key and public key encryption, Problem (...

Problem (a) Differentiate between private key and public key encryption. (b) What issue with private key encryption is resolved with public key encryption? (c) Describe

Selecting a risk control strategy, Selecting a Risk Control Strategy Risk...

Selecting a Risk Control Strategy Risk controls involve selecting one of the 4 risk control strategies for every vulnerability. The flowchart is shown in the figure given below

Identified issues in networks, The "Big Red Rocks" (BRR) mining company is ...

The "Big Red Rocks" (BRR) mining company is based and operates in Western Australia. They are primarily an iron ore miner, but they also produce electricity through tidal power to

Man-in-the-middle attacker, - Alice, Bob and Charlie have a secret key a=3,...

- Alice, Bob and Charlie have a secret key a=3, b=4, c=5, in that order. - They would like to find a common secret key using Diffie-Hellan key exchange protocol (with g=2, p=5).

Explain transposition ciphers and substitution cipher, What do you understa...

What do you understand by cryptanalysis? Discuss about the transposition ciphers substitution cipher, and onetime pads. The messages which are intended to transmit secretly and

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd