Cracking the Vigenere Cipher, Computer Network Security

Assignment Help:

The following message was enciphered with a Vigenère cipher.

aikiaawgfspxeppvjabjnivulfznzvkrlidamsmyamlvskniyffdpbwtnxsvvbtnamvltsefoeycztkomylmerkwrs

deusjgecmzkwvnreeypnnosdahjepkujejwttymoeatnvtipafsvgjnvtrlkauiwertshdtasqmfaooltxjiehrzmcpcosdiz

szukzezpeoehevrrajlsarlmzjimayddscnyzsyahnczucvqnkptywmedpbllwqedpzliuagieysaljtismaeowzllghpiifijt

padeegedszfgrtsuikhnyrucqhbpcaugqnymeujscppdrxxrrehzkarevauemgttnxvvvnvdiazvnrwyaprdlneqjbxsaj

gzrrnodwetrziearwucydsxpharvnmrwdolllnmatffweeeuifxbtsegjiziprcwetuphrkwreytywqghconfmaaetywhreae

evavtsbfllzaycywwgecccmffaydeganrdeespseltljmagtnkzivrqiikxsofrdsxphpsffxueqiolyeewijlwbpprystfiesegw

hrarzkighltkzivrqiikxrvprkjmctztywizicakwwpoxejomghehvewgiwlcgsxiygwgvghpiixmesepfargszfkzifelsffwniyt

jsvrtseffpltpadarghppiwqveclvskhejeklsteeowxxuexaiceadehvjinrppcwrgyzfjlegslrfmrqsfgxwwgiyggjszoeeulin

mdwygpbsptywmeftrjlxurpexsqrslrvvsbmpdfxgbucsvllryweuskniysktsghnikqeadfnzliqsnoiartthitwmaelcyyeze

ehvzszeoewwegtztygwrthocsxrrzbzfznnaeikmrgzackjbrfnzliqmfskzeiemevftnreitmpnrwyxspyiygrfhghptnwrgy

oewwegbjwzyeaaeskeeeydijhvrctsvdcghpsfjxbfcejmpgtsepzeieeornsvdtfkzilrptfymieehvewrlgejshrcpnkuln

nnefxwgajieyycacsvfeywprvaqcrpsjazrllsklmzezukarntheelcjiyakdmiecpfgpjiehcmonsaougpfktaevwnneits

dbrwajuseiygkzivrqiikxtolljxsetsetdyotsepoieelljgeespnrdwsicskysnldowllrspajgrzodtcqqvsqiiartaeoewiad

ehvyyanprjzeiemevfwbltdrlxueztywvrnoowllrptttzxurpetdinndhvwxfiyaigazavejaxghpccmffbpskkxnretfswra

doeviseyszniyyqoiwmtheyvakutjerjwghpymwrrvprxgrrfzuiyezedwzllbuecffgrdtnxsxghpsksvgoqajwefoyiellrtz

puazvstoesrqielctivneeiwwgiygkgwretfcswgspajgrftzpjuseecszfxuenhretvoysyatrirhkqjvvpcrfxeofbcwxuexhv

jinfeeizeiiygjgqrsfctwwfarazfwgtsedsrphpskwvplfbjaxfbpeesauiwejarpeehvkigwzccmffllskeigiytywpraruvwzv

dpntwhoyehvxeptehrlwbuehretgoyscswgvtszlxbtsejwtnresnswntciglsuirhsmvlfzrrlabthoujejiytngxuofsrfhnno

ffmvghpiidefthiesanyltrjwrnlltsqrtheelcsigepweeslgfolrnoaefcjawlruifczrvvxuezncqkbawowllrglmvsvfeyaczei

eoodarntpdkzmfftxkmvriynfjxulznugrrvprjarpedoljgrbmcjhsetd


Show all your steps including:
? The Kasiski’s test
? Hypotheses of the probable period(s) and their assessment using index of coincidence calculations.
? Using correlation function<


a) (5pts) Perform a frequency analysis on the ciphertext and plot a figure that looks like the one shown below (this is slide 12 in CH02.pptx). How do both plots relate to one another?

b) (5pts) Kasiski’s test


Related Discussions:- Cracking the Vigenere Cipher

What is meant by certificate revocation, QUESTION (a) Which PKI (Public...

QUESTION (a) Which PKI (Public Key Infrastructure) model is typically favored by business organization? (b) Give one possible use of the "extensions" field of an X.509 certi

Explain belady''s anomaly, Belady's Anomaly Also known FIFO anomaly. G...

Belady's Anomaly Also known FIFO anomaly. Generally, on raising the number of frames given to a process' virtual storage, the program execution is faster, because lesser page

Differences between a hacker and a cracker, Question: (a) Which of the...

Question: (a) Which of the following is not a goal of security: i) detection ii) prevention iii) recovery iv) prosecution (b) You are an honest student. One day you

Explain the limitations of a firewall, Question: (a) Mention three lim...

Question: (a) Mention three limitations of a firewall. (b) Compare packet-filtering and proxy-base firewalls. Give advantages and drawbacks of both. (c) "Proxies eff

Example of a public key algorithm, Question : (a) There are two approa...

Question : (a) There are two approaches for providing confidentiality for packets in a network using symmetric encryption: End-to-End Encryption and Link Encryption. State wh

Define network, A Network is described as a system for connecting compu...

A Network is described as a system for connecting computers using a single transmission technology. The computers can interact with each other in a network. They can receive an

X.509, Consider the details of the X.509 certificate shown below. a. Identi...

Consider the details of the X.509 certificate shown below. a. Identify the key elements in this certificate, including the owner''s name and public key, its validity dates, the nam

Access controls-information security, Access Controls Access controls ad...

Access Controls Access controls addresses admission of a user into a trusted area of organization. It comprises of a combination of policies & technologies. The ways to control

Difference between synchronous tdm and statistical tdm, Question (a) A CRC...

Question (a) A CRC is constructed to generate a 4-bit FCS for an 11-bit message. The divisor polynomial is X 4 + X 3 + 1 (i) Encode the data bit sequence 00111011001 using po

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd