Cracking the Vigenere Cipher, Computer Network Security

Assignment Help:

The following message was enciphered with a Vigenère cipher.

aikiaawgfspxeppvjabjnivulfznzvkrlidamsmyamlvskniyffdpbwtnxsvvbtnamvltsefoeycztkomylmerkwrs

deusjgecmzkwvnreeypnnosdahjepkujejwttymoeatnvtipafsvgjnvtrlkauiwertshdtasqmfaooltxjiehrzmcpcosdiz

szukzezpeoehevrrajlsarlmzjimayddscnyzsyahnczucvqnkptywmedpbllwqedpzliuagieysaljtismaeowzllghpiifijt

padeegedszfgrtsuikhnyrucqhbpcaugqnymeujscppdrxxrrehzkarevauemgttnxvvvnvdiazvnrwyaprdlneqjbxsaj

gzrrnodwetrziearwucydsxpharvnmrwdolllnmatffweeeuifxbtsegjiziprcwetuphrkwreytywqghconfmaaetywhreae

evavtsbfllzaycywwgecccmffaydeganrdeespseltljmagtnkzivrqiikxsofrdsxphpsffxueqiolyeewijlwbpprystfiesegw

hrarzkighltkzivrqiikxrvprkjmctztywizicakwwpoxejomghehvewgiwlcgsxiygwgvghpiixmesepfargszfkzifelsffwniyt

jsvrtseffpltpadarghppiwqveclvskhejeklsteeowxxuexaiceadehvjinrppcwrgyzfjlegslrfmrqsfgxwwgiyggjszoeeulin

mdwygpbsptywmeftrjlxurpexsqrslrvvsbmpdfxgbucsvllryweuskniysktsghnikqeadfnzliqsnoiartthitwmaelcyyeze

ehvzszeoewwegtztygwrthocsxrrzbzfznnaeikmrgzackjbrfnzliqmfskzeiemevftnreitmpnrwyxspyiygrfhghptnwrgy

oewwegbjwzyeaaeskeeeydijhvrctsvdcghpsfjxbfcejmpgtsepzeieeornsvdtfkzilrptfymieehvewrlgejshrcpnkuln

nnefxwgajieyycacsvfeywprvaqcrpsjazrllsklmzezukarntheelcjiyakdmiecpfgpjiehcmonsaougpfktaevwnneits

dbrwajuseiygkzivrqiikxtolljxsetsetdyotsepoieelljgeespnrdwsicskysnldowllrspajgrzodtcqqvsqiiartaeoewiad

ehvyyanprjzeiemevfwbltdrlxueztywvrnoowllrptttzxurpetdinndhvwxfiyaigazavejaxghpccmffbpskkxnretfswra

doeviseyszniyyqoiwmtheyvakutjerjwghpymwrrvprxgrrfzuiyezedwzllbuecffgrdtnxsxghpsksvgoqajwefoyiellrtz

puazvstoesrqielctivneeiwwgiygkgwretfcswgspajgrftzpjuseecszfxuenhretvoysyatrirhkqjvvpcrfxeofbcwxuexhv

jinfeeizeiiygjgqrsfctwwfarazfwgtsedsrphpskwvplfbjaxfbpeesauiwejarpeehvkigwzccmffllskeigiytywpraruvwzv

dpntwhoyehvxeptehrlwbuehretgoyscswgvtszlxbtsejwtnresnswntciglsuirhsmvlfzrrlabthoujejiytngxuofsrfhnno

ffmvghpiidefthiesanyltrjwrnlltsqrtheelcsigepweeslgfolrnoaefcjawlruifczrvvxuezncqkbawowllrglmvsvfeyaczei

eoodarntpdkzmfftxkmvriynfjxulznugrrvprjarpedoljgrbmcjhsetd


Show all your steps including:
? The Kasiski’s test
? Hypotheses of the probable period(s) and their assessment using index of coincidence calculations.
? Using correlation function<


a) (5pts) Perform a frequency analysis on the ciphertext and plot a figure that looks like the one shown below (this is slide 12 in CH02.pptx). How do both plots relate to one another?

b) (5pts) Kasiski’s test


Related Discussions:- Cracking the Vigenere Cipher

List vulnerabilities of using wep, Question: The Wired Equivalent Priv...

Question: The Wired Equivalent Privacy (WEP) standard was created in order to give wireless networks safety and security features similar to that of wired networks. (a) L

Application-based ids, Application-Based IDS Application-based IDS (AppI...

Application-Based IDS Application-based IDS (AppIDS) is an advanced version of HIDS. It examines application for abnormal events. The ability to view encrypted data is the uniqu

Corresponding access control matrix, Consider a computer system with three ...

Consider a computer system with three users: Alice, Bob and Cindy. Alice owns the file alicerc, and Bob and Cindy can read it. Cindy can read and write the file bobrc, which Bob ow

Direct indexing, DIRECT INDEXING It is less usually known method. It i...

DIRECT INDEXING It is less usually known method. It is possible only is cases where protocols address are given from a compact range. In the diagram below an example of direct

Virtual terminal protocol vtp, Write down the short notes on VTR.  Communic...

Write down the short notes on VTR.  Communication between different types of the equipment and software is made possible by making use of the networks. Full-screen text editor is s

Information security policy practices and standards, INFORMATION SECURITY P...

INFORMATION SECURITY POLICY PRACTICES AND STANDARDS Management from all the communities of interest should consider policies as basis for all information security efforts. Polic

Difference between synchronous tdm and statistical tdm, Question (a) A CRC...

Question (a) A CRC is constructed to generate a 4-bit FCS for an 11-bit message. The divisor polynomial is X 4 + X 3 + 1 (i) Encode the data bit sequence 00111011001 using po

Address masks, ADDRESS MASKS To identify receiver, network apply addre...

ADDRESS MASKS To identify receiver, network apply address mask to receiver address and calculate to network address in routing table. It can use Boolean 'and' to calculate the

Quote, How much would it cost to have a project completed by tomorrow night...

How much would it cost to have a project completed by tomorrow night?

Describe the terms prime number and prime factorisation, (a) An opponent is...

(a) An opponent is using RSA with the public key {e=53, n=77}. You intercept the ciphertext C=10. (All values on this problem, including the ciphertext and the cleartext, are nume

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd