Cracking the Vigenere Cipher, Computer Network Security

Assignment Help:

The following message was enciphered with a Vigenère cipher.

aikiaawgfspxeppvjabjnivulfznzvkrlidamsmyamlvskniyffdpbwtnxsvvbtnamvltsefoeycztkomylmerkwrs

deusjgecmzkwvnreeypnnosdahjepkujejwttymoeatnvtipafsvgjnvtrlkauiwertshdtasqmfaooltxjiehrzmcpcosdiz

szukzezpeoehevrrajlsarlmzjimayddscnyzsyahnczucvqnkptywmedpbllwqedpzliuagieysaljtismaeowzllghpiifijt

padeegedszfgrtsuikhnyrucqhbpcaugqnymeujscppdrxxrrehzkarevauemgttnxvvvnvdiazvnrwyaprdlneqjbxsaj

gzrrnodwetrziearwucydsxpharvnmrwdolllnmatffweeeuifxbtsegjiziprcwetuphrkwreytywqghconfmaaetywhreae

evavtsbfllzaycywwgecccmffaydeganrdeespseltljmagtnkzivrqiikxsofrdsxphpsffxueqiolyeewijlwbpprystfiesegw

hrarzkighltkzivrqiikxrvprkjmctztywizicakwwpoxejomghehvewgiwlcgsxiygwgvghpiixmesepfargszfkzifelsffwniyt

jsvrtseffpltpadarghppiwqveclvskhejeklsteeowxxuexaiceadehvjinrppcwrgyzfjlegslrfmrqsfgxwwgiyggjszoeeulin

mdwygpbsptywmeftrjlxurpexsqrslrvvsbmpdfxgbucsvllryweuskniysktsghnikqeadfnzliqsnoiartthitwmaelcyyeze

ehvzszeoewwegtztygwrthocsxrrzbzfznnaeikmrgzackjbrfnzliqmfskzeiemevftnreitmpnrwyxspyiygrfhghptnwrgy

oewwegbjwzyeaaeskeeeydijhvrctsvdcghpsfjxbfcejmpgtsepzeieeornsvdtfkzilrptfymieehvewrlgejshrcpnkuln

nnefxwgajieyycacsvfeywprvaqcrpsjazrllsklmzezukarntheelcjiyakdmiecpfgpjiehcmonsaougpfktaevwnneits

dbrwajuseiygkzivrqiikxtolljxsetsetdyotsepoieelljgeespnrdwsicskysnldowllrspajgrzodtcqqvsqiiartaeoewiad

ehvyyanprjzeiemevfwbltdrlxueztywvrnoowllrptttzxurpetdinndhvwxfiyaigazavejaxghpccmffbpskkxnretfswra

doeviseyszniyyqoiwmtheyvakutjerjwghpymwrrvprxgrrfzuiyezedwzllbuecffgrdtnxsxghpsksvgoqajwefoyiellrtz

puazvstoesrqielctivneeiwwgiygkgwretfcswgspajgrftzpjuseecszfxuenhretvoysyatrirhkqjvvpcrfxeofbcwxuexhv

jinfeeizeiiygjgqrsfctwwfarazfwgtsedsrphpskwvplfbjaxfbpeesauiwejarpeehvkigwzccmffllskeigiytywpraruvwzv

dpntwhoyehvxeptehrlwbuehretgoyscswgvtszlxbtsejwtnresnswntciglsuirhsmvlfzrrlabthoujejiytngxuofsrfhnno

ffmvghpiidefthiesanyltrjwrnlltsqrtheelcsigepweeslgfolrnoaefcjawlruifczrvvxuezncqkbawowllrglmvsvfeyaczei

eoodarntpdkzmfftxkmvriynfjxulznugrrvprjarpedoljgrbmcjhsetd


Show all your steps including:
? The Kasiski’s test
? Hypotheses of the probable period(s) and their assessment using index of coincidence calculations.
? Using correlation function<


a) (5pts) Perform a frequency analysis on the ciphertext and plot a figure that looks like the one shown below (this is slide 12 in CH02.pptx). How do both plots relate to one another?

b) (5pts) Kasiski’s test


Related Discussions:- Cracking the Vigenere Cipher

Analysis phase in the building-block approach, QUESTION: a) Explain fou...

QUESTION: a) Explain four issues that are generally addressed in the Needs Analysis phase in the building-block approach to network design. b) Sketch a typical hybrid star-b

Computer forensic, discuss the merits and demerits of computers freezing

discuss the merits and demerits of computers freezing

Explain how ftp works, QUESTION (a) FTP is a protocol used for the de...

QUESTION (a) FTP is a protocol used for the delivery of files across networks. Explain how FTP works (support your answer with a diagram). (b) How does TCP perform the gi

Risk determination, Risk Determination For purpose of relative risk asse...

Risk Determination For purpose of relative risk assessment, risk equals probability of vulnerability occurrence TIMES value MINUS percentage risk already controlled PLUS an elem

Efforts of advanced research project agency, ADVANCED RESEARCH PROJECT AGEN...

ADVANCED RESEARCH PROJECT AGENCY (ARPA) The efforts of ARPA was to active all its research groups have accept to new era computers. For this purpose ARPA started investing in wa

Define checksum, The method used to check errors is checksum . In this m...

The method used to check errors is checksum . In this method data is treated as a sequence of integers and their arithmetic sum is calculated and the carry bits are added to the

Direct indexing, DIRECT INDEXING It is less usually known method. It i...

DIRECT INDEXING It is less usually known method. It is possible only is cases where protocols address are given from a compact range. In the diagram below an example of direct

Example of a public key algorithm, Question : (a) There are two approa...

Question : (a) There are two approaches for providing confidentiality for packets in a network using symmetric encryption: End-to-End Encryption and Link Encryption. State wh

Emerging threats related to use of networks, Question requires you to submi...

Question requires you to submit a proposal based on the research report topic you will be addressing in the second assignment.  Note:  before commencing research on the topic, y

Explain how inter-vlan communication, QUESTION a) A switch basically ...

QUESTION a) A switch basically operates by forwarding frames from one part of the network to another, based on MAC address. Describe the three types of switching namely store

Write Your Message!

Captcha
Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd