Explain a blast search query amino acid sequence

Assignment Help Biology

Reference no: EM1339790

Supplied below is a query amino acid sequence. Perform a BLAST Search Query Amino Acid Sequence.

MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSâ?¦

Perform a search to find amino acid sequences of the database similar to the query amino acid sequence supplied
[Hint: Select â??Standard Protein â?" protein BLAST [blastp]â? under the â??Protein BLAST â??option]
Continue the search procedure to reach the page that contains results. Using the results answering the following:

(a) Why does an amino acid query sequence leads to a higher similarity than a nucleotide query sequence? (Hint: genetic code)

(b) Identify 5 database sequences that are very closely similar to the query sequence. For them list the following:

o Name of the protein;
o Source (organism/tissue) of the protein;
o The amino acid identity;
o Similarity scores;
o E-values;
o Percentage of identity
o Percentage positives (that is, similar amino acids)
o Find the animals (apart from those five listed earlier) have this (query), protein with a similarity score in excess of 220 bits.

Please use doc or docx program to answer.

Reference no: EM1339790

Questions Cloud

What syndrome is defined by an xxx genotype : How is sex determined in grasshoppers? Can you find out other examples of organisms with a similar system of sex determination.What syndrome is defined by an XXX genotype.

About new deal assistance : Although the New Deal extended help to many Americans, all did not benefit equally from the era's reforms.

Explain contracting- truth and negotiations act : Explain Contracting- Truth and Negotiations Act and What role does this legislation play in contract pricing/contract management

Maximum loan by an employee of a c corporation : Determine the maximum loan taken by an employee of a C corporation.

Explain a blast search query amino acid sequence : Perform a search to find out amino acid sequences of the database similar to the query amino acid sequence supplied. explain a BLAST Search Query Amino Acid Sequence.

Advantages of using a high-moderate-low risk : What are the advantages of using a high-moderate-low (or red-yellow-green) risk designation as opposed to assigning quantitative numbers to each cell and risk level ?

Explain it management -automated contract preperation tools : Explain IT Management -Automated Contract Preperation Tools and Summarize an overview of each tool as well as the pluses and minuses of each tool into an executive level

Explain how would you expect antitrust authorities to react : Important information about Antitrust policy explain how would you expect antitrust authorities to react.

Explain the protection of intellectual property in a busines : Explain The protection of intellectual property in a business setting and What types of intellectual property do you see in your professional lives

User Account

All Pages