Reference no: EM1339790

Supplied below is a query amino acid sequence. Perform a BLAST Search Query Amino Acid Sequence.

MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSâ?¦

Perform a search to find amino acid sequences of the database similar to the query amino acid sequence supplied
[Hint: Select â??Standard Protein â?" protein BLAST [blastp]â? under the â??Protein BLAST â??option]
Continue the search procedure to reach the page that contains results. Using the results answering the following:

(a) Why does an amino acid query sequence leads to a higher similarity than a nucleotide query sequence? (Hint: genetic code)

(b) Identify 5 database sequences that are very closely similar to the query sequence. For them list the following:

o Name of the protein;
o Source (organism/tissue) of the protein;
o The amino acid identity;
o Similarity scores;
o E-values;
o Percentage of identity
o Percentage positives (that is, similar amino acids)
o Find the animals (apart from those five listed earlier) have this (query), protein with a similarity score in excess of 220 bits.

Please use doc or docx program to answer.