Already have an account? Get multiple benefits of using own account!
Login in your account..!
Remember me
Don't have an account? Create your account in less than a minutes,
Forgot password? how can I recover my password now!
Enter right registered email to receive password!
Supplied below is a query amino acid sequence. Perform a BLAST Search Query Amino Acid Sequence.
MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSâ?¦
Perform a search to find amino acid sequences of the database similar to the query amino acid sequence supplied[Hint: Select â??Standard Protein â?" protein BLAST [blastp]â? under the â??Protein BLAST â??option]Continue the search procedure to reach the page that contains results. Using the results answering the following:
(a) Why does an amino acid query sequence leads to a higher similarity than a nucleotide query sequence? (Hint: genetic code)
(b) Identify 5 database sequences that are very closely similar to the query sequence. For them list the following:
o Name of the protein;o Source (organism/tissue) of the protein;o The amino acid identity;o Similarity scores;o E-values;o Percentage of identityo Percentage positives (that is, similar amino acids)o Find the animals (apart from those five listed earlier) have this (query), protein with a similarity score in excess of 220 bits.
Please use doc or docx program to answer.
What is the circumference of their spherical world if they see the similar star on their meridian at altitudes of 23 degrees and 47 degrees respectively, and at the exact same time.
Many infected animals are induced by the parasitic microsporidians to develop huge cells, known as xenomas, which are full of spores. Given their large size, what must be true of the xenomas.
Structure and based analysis of proteins
How does your individual TRC and those of the average of class compare with the average TRC of the general population as reported by Holt (1968) as 145 for male and 126 for female.
Explain a muscle contraction beginning with the motor neuron to relaxation of the muscle. Discuss the physiological relationship of the muscular and skeletal system.
as there is no blocking proline by either the Arg or Lys. I am stumped--what am I missing.
When mendel crossed yellow-seeded and green-seeded pea plants, all of offspring were yellow seeded. As he took these yellow-seeded plants and crossed then with green- seeded plants what genotypic ratio is expected.
A blue-eyed man marries a brown-eyed woman; and they have six children, all brown-eyed. What is the most likely genotype of the father?
What is the yield of ATP when each of the following substrates is completely oxidized to CO2 by a mammalian cell homogenate.
What are the roles of COPI vesicles for transporting proteins between Golgi cisternae. How does a new Golgi cisterna form in the cis side from COPII vesicles.
After much persuasion, Vanessa has finally consented to go away for a romantic weekend at a seaside resort where Eric has promised to "teach her about sex." Vanessa is both increasingly anxious about the coming weekend and enjoying fantasies of being..
What type of electrode would they need to use (express material and design)? Provide a simplified schematic (circuit model of the electrode) described in the notes. Also discuss at least two benefits of an exoskeleton as well as how arthropod grows ..
Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!
whatsapp: +1-415-670-9521
Phone: +1-415-670-9521
Email: [email protected]
All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd