User Account

All Pages

Determine the total charge for each peptide

Assignment Help Chemistry
Reference no: EM131706785

Question - Three polypeptides listed below are in a mixture. Determine the total charge for each peptide at pH 7.0, then, of the three, which would migrate most rapidly (i.e. elute first) through a strong anion-exchange resin at pH 7.0?

ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG

GPYFGDEPLDVHDEPEEG

PHLLSAWKGMEGVGKSQSFAALIVILA

Reference no: EM131706785

Questions Cloud

Describe the structure of a glycogen molecule : Glycogen metabolism - Describe the structure of a glycogen molecule. What is the advantage of its branched structure
Transition from this excited state to the ground state : What is the wavelength of the radiation emitted when an atom of Al undergoes a transition from this excited state to the ground state?
Analyze the restrictions on arbitrage transactions imposed : Analyze the restrictions on arbitrage transactions imposed by federal regulations and potential consequences for violation of the regulations.
Describe the taft-hartley act : What restrictions are placed on union officers by the Taft-Hartley Act and the Labor Management Reporting and Disclosure Act amendments to the NLRA?
Determine the total charge for each peptide : Determine the total charge for each peptide at pH 7.0, then, of the three, which would migrate most rapidly through a strong anion-exchange resin at pH 7.0
Suggest an intracellular regulatory molecule : Suggest an intracellular regulatory molecule that growth factors might stimulate to control cell division. Please describe how it works?
Discuss addicted to pornography or stealing : Contrast the difference between someone who is addicted to heroin verses someone who is addicted to pornography or stealing
Representation to the discharged postal worker : However, the union's general counsel advised against arbitration on the ground that there was little likelihood of success.
Determining the genotypes of the parents : Please assist him by determining the genotypes of the parents and all of the offspring. Express the genotypes both symbolically and in words.

Reviews

Write a Review

Chemistry Questions & Answers

  According to the following reaction

According to the following reaction, what volume of 0.244 M KCl solution is required to react exactly with 50.0mL of 0.210 M Pb(NO3)2 solution?

  Explain titrate the excess potassium dichromate

If 0.5mL of .3% (mass) ethanol is oxidized with 10mL 0.005M K2Cr2O7 , what volume of 0.05M Fe(NH4)2(SO4)2.6H2O is needed to titrate the excess potassium dichromate

  Explain gas boiling matographic analysis of the product

Gas boiling matographic analysis of the product showed that the compound was pure, and a calibration of the thermometer indicated that it was accurate. What procedural error might the student have made in setting up the distillation apparatus

  Find out the density of a piece of metal a student finds

Find out the density of a piece of metal a student finds it's mass to be 13.62 g. The metal is placed into a flask that can hold exactly 25.00mL. The student determines that 19.26 g of water is required to fill the flask.

  Define what are the required steps in the synthesis reaction

What are the required steps in the synthesis reaction of tert-butanol only using Ethanol (CH3CH2OH) and Methane (CH4)

  Lime reacts with sulfur dioxide to form calcium sulfite

Limestone (CaCO3) is used to remove acidic pollutants from smokestack flue gases. It is heated to form lime (CaO), which reacts with sulfur dioxide to form calcium sulfite

  Explain how many milligrams of carbon monoxide

Explain how many milligrams of carbon monoxide does the average person inhale in a 6 hour period for this level of carbon monoxide pollution. Presume that carbon monoxide has a density of 1.2g/L.

  Compute the percentage of protein in the flour

A 0.9092-g sample of wheat flour was analyzed by the Kjeldahl procedure. The ammonia formed was distilled into 50.00mL of 0.05063 M HCl; a 7.46-mL back-titration with 0.04917 M NaOH was required. Calculate the percentage of protein in the flour.

  Explain what would be the benefit of using a hirsch funnel

Why did the book suggest using a Hirsch funnel? What would be the benefit of using a Hirsch funnel?

  What was the initial concentration of ammonia

A sample of ammonia gas was allowed to come to equilibrium at 400 K.2NH3(g) ↔ N2(g) + 3H2(g) At equilibrium, it was found that the concentration of H2 was 0.0584 M, the concentration of N2 was 0.0195 M, and the concentration of NH3 was 0.430 M.

  Write the symbol for the element''s most abundant isotope

How many times heavier than 12C is the average atom of this element?

  What is the molecular formula of the dissolved s molecules

The boiling point of pure CS2 is 46.30 oC, and its boiling point elevation constant Kb is 2.34 oC/m. A solution of sulfur in liquid CS2, which was prepared by dissolving 2.26 g S in 50.0 g CS2, boils at 46.71oC. What is the molecular formula of th..

Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

Submit Assignment

Academics

Major Subjects

Majors

Get In Touch

whatsapp: +1-415-670-9521

Phone: +1-415-670-9521

Email: [email protected]

TERMS & POLICIES

HELP & SUPPORT

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd