Already have an account? Get multiple benefits of using own account!
Login in your account..!
Remember me
Don't have an account? Create your account in less than a minutes,
Forgot password? how can I recover my password now!
Enter right registered email to receive password!
Question - Three polypeptides listed below are in a mixture. Determine the total charge for each peptide at pH 7.0, then, of the three, which would migrate most rapidly (i.e. elute first) through a strong anion-exchange resin at pH 7.0?
ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG
GPYFGDEPLDVHDEPEEG
PHLLSAWKGMEGVGKSQSFAALIVILA
According to the following reaction, what volume of 0.244 M KCl solution is required to react exactly with 50.0mL of 0.210 M Pb(NO3)2 solution?
If 0.5mL of .3% (mass) ethanol is oxidized with 10mL 0.005M K2Cr2O7 , what volume of 0.05M Fe(NH4)2(SO4)2.6H2O is needed to titrate the excess potassium dichromate
Gas boiling matographic analysis of the product showed that the compound was pure, and a calibration of the thermometer indicated that it was accurate. What procedural error might the student have made in setting up the distillation apparatus
Find out the density of a piece of metal a student finds it's mass to be 13.62 g. The metal is placed into a flask that can hold exactly 25.00mL. The student determines that 19.26 g of water is required to fill the flask.
What are the required steps in the synthesis reaction of tert-butanol only using Ethanol (CH3CH2OH) and Methane (CH4)
Limestone (CaCO3) is used to remove acidic pollutants from smokestack flue gases. It is heated to form lime (CaO), which reacts with sulfur dioxide to form calcium sulfite
Explain how many milligrams of carbon monoxide does the average person inhale in a 6 hour period for this level of carbon monoxide pollution. Presume that carbon monoxide has a density of 1.2g/L.
A 0.9092-g sample of wheat flour was analyzed by the Kjeldahl procedure. The ammonia formed was distilled into 50.00mL of 0.05063 M HCl; a 7.46-mL back-titration with 0.04917 M NaOH was required. Calculate the percentage of protein in the flour.
Why did the book suggest using a Hirsch funnel? What would be the benefit of using a Hirsch funnel?
A sample of ammonia gas was allowed to come to equilibrium at 400 K.2NH3(g) ↔ N2(g) + 3H2(g) At equilibrium, it was found that the concentration of H2 was 0.0584 M, the concentration of N2 was 0.0195 M, and the concentration of NH3 was 0.430 M.
How many times heavier than 12C is the average atom of this element?
The boiling point of pure CS2 is 46.30 oC, and its boiling point elevation constant Kb is 2.34 oC/m. A solution of sulfur in liquid CS2, which was prepared by dissolving 2.26 g S in 50.0 g CS2, boils at 46.71oC. What is the molecular formula of th..
Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!
whatsapp: +1-415-670-9521
Phone: +1-415-670-9521
Email: [email protected]
All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd