Determine the total charge for each peptide

Assignment Help Chemistry
Reference no: EM131706785

Question - Three polypeptides listed below are in a mixture. Determine the total charge for each peptide at pH 7.0, then, of the three, which would migrate most rapidly (i.e. elute first) through a strong anion-exchange resin at pH 7.0?

ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG

GPYFGDEPLDVHDEPEEG

PHLLSAWKGMEGVGKSQSFAALIVILA

Reference no: EM131706785

Questions Cloud

Describe the structure of a glycogen molecule : Glycogen metabolism - Describe the structure of a glycogen molecule. What is the advantage of its branched structure
Transition from this excited state to the ground state : What is the wavelength of the radiation emitted when an atom of Al undergoes a transition from this excited state to the ground state?
Analyze the restrictions on arbitrage transactions imposed : Analyze the restrictions on arbitrage transactions imposed by federal regulations and potential consequences for violation of the regulations.
Describe the taft-hartley act : What restrictions are placed on union officers by the Taft-Hartley Act and the Labor Management Reporting and Disclosure Act amendments to the NLRA?
Determine the total charge for each peptide : Determine the total charge for each peptide at pH 7.0, then, of the three, which would migrate most rapidly through a strong anion-exchange resin at pH 7.0
Suggest an intracellular regulatory molecule : Suggest an intracellular regulatory molecule that growth factors might stimulate to control cell division. Please describe how it works?
Discuss addicted to pornography or stealing : Contrast the difference between someone who is addicted to heroin verses someone who is addicted to pornography or stealing
Representation to the discharged postal worker : However, the union's general counsel advised against arbitration on the ground that there was little likelihood of success.
Determining the genotypes of the parents : Please assist him by determining the genotypes of the parents and all of the offspring. Express the genotypes both symbolically and in words.

Reviews

Write a Review

Chemistry Questions & Answers

  Steps in the mechanism for the following reaction

Show all the steps in the mechanism for the following reaction, When benzene is mixed with deuterated sulfuric acid, deuterium is slowly incorporated onto the ring. Show the mechanism for this reaction and explain how this relates the sulfonation of ..

  Prior to placing piece of metal into the graduated cylinder

This assignment inhibits chemistry Laboratory Questions.

  Write the structures of the saytzeff elimination

Write the structures of the saytzeff elimination

  Calculate ph - chemistry questions

Chemistry Questions on Calculate P H

  How many mols of hydrogen can produce

how many mols of H 2 can produce

  Analysis of corrosion mechanisms

Analysis of corrosion mechanisms and preventative measures

  Chemical and pharmaceutical science

Write an equation for the formation of an acetal from reaction of excess methanol with benzaldehyde in the presence of an acid catalyst.

  Calculate the approximate sulphur

Calculate the approximate SO 2 mass emission in lb/day.

  What is the structure - stereochemistry

What is the structure (including functional groups)? Stereochemistry (racemic or single enantiomer)?

  Design a qualitative analysis scheme

Design a qualitative analysis scheme

  What will be the resultant pressure

What will be the resultant pressure when the stopcock is opened?

  The 1h nmr spectrum

Integrals for some of the resonances in the 1H NMR spectrum are higher than they should be due to the shear number of hydrogens in this compound

Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd