Design two degenerate primer sequences

Assignment Help Biology

Reference no: EM1383719

Here is the amino acid sequence of the enzyme (in single letter code):

MAAMDMDQFLAAAIDAAKKAGQIIRKGFYETKHVEHKGQVDLVTETDKGCEELVFNHLKQLFPNHKFIGEETTAAFGVTELTDEPTWIVDPLDGTTNFVHGFPFVCVSIGLTIGKVPVVGVVYNPIMEELFTGVQGKGAFLNGKRIKVSAQSELLTALLVTEAGTKRDKATLDDTTNRINSLLTKVRSLRMSGSCALDLCGVACGRVDIFYELGFGGPWDIAAGIVIVKEAGGLIFDPSGKDLDITSQRIAASNASLKELFAEAMMLTAA

Design two degenerate primer sequences that will amplify the entire Open reading frame (ORF) of the corresponding gene in a PCR reaction. To facilitate the cloning of the gene after PCR amplification, place a restriction endonuclease site at each end of your primers. You may choose any restriction endonuclease site you like, or use EcoRI (GAATTC). Hints: restriction endonuclease sites are cleaved more efficiently when 1-2 extra nucleotides are included at each end; these extra nucleotides are usually Gs or Cs. You need a forward and a reverse primer. In general, primers that are 18-30 nucleotides long are suitable for PCR amplification. Write out your primer sequences 5’ to 3’.

1. Forward primer sequence:

2. Reverse primer sequence:

Reference no: EM1383719

Questions Cloud

Survey questions about globalization : The survey must allow to gather information about the effects and influence of neocolonialism, globalization, or multinational corporations.

City to consider the particulars of the circumstances : Do you think that it would have made sense for the city to consider the particulars of the circumstances here, such as that these were life guards, in a remote location

Storativity of a confined aquifer : The storativity of a confined aquifer is found to be 6.8 x 10 -4 as a result of a pumping test. The thickness of the aquifer is about 50m and the porosity is about 0.25 .

Create the flowchart for program to accept candy name : Create the flowchart or pseudocode for following:a. A program which accepts the candy name (for instance, "chocolate-covered blueberries"), price per pound, and number of pounds sold in average month

Design two degenerate primer sequences : Develop two degenerate primer sequences that will amplify the entire Open reading frame of the corresponding gene in a PCR reaction.

Maximum hydraulic conductivity in an aquifer : Using your knowledge of the two-dimensional, anisotropic forms of Darcy's Law, estimate the magnitude and direction of groundwater flow at this site. Sketch a conceptual model of this situation, show all calculations and results.

Explain the origin of dna fragments : Genomic DNA from the nematode worm Caenorhabditis elegans is organized through nucleosomes in the manner typical of eukaryotic genomes, with 145 bp encircling each nucleosome and approximately fifty-five bp in linker DNA.

Monetary policy action on the investment market : Monetary Policy action on the Investment Market - Show the result of this Monetary Policy action on the Investment Market and the Goods and Services (AS/AD) Market.

Knowing a typical water retention curve for sand : Knowing a typical water retention curve for sand, fine sand, and a silt loam- Based on the behavior of these soils in terms of moisture content versus negative (suction) pore pressure, discuss briefly in a paragraph or two the advantages and disad..

User Account

All Pages