Biochemist isolates a peptide hormone

Assignment Help Biology
Reference no: EM1384039

A biochemist isolates a peptide hormone with the following sequence:

 

ADSERNCQLVILLAWLPGVKVQCALLDRET

 

(a) Indicte the residues that could contribute a positive charge.

(b) Which residues that could contribute a negative charge.

(c) List the residues that could be connected by a disulfide bond.

To be totally honest, I have absolutely no idea how to approach this question, and my textbook isn't very helpful. Can someone please explain (clearly, and thorougly as possible, please!) how I am supposed to figure out which residues contribute what charge from a sequence??

Reference no: EM1384039

Questions Cloud

Differences in family since 1950 : Discuss some differences in family since the 1950's to the present? An explanation of why this occurred. Compare and contrast the differences in marriage and family with relation to race
Length of the curve-elevation of the curve at station : A vertical curve is to connect two tangents that intersect at station 50+00 and the elevation 500.00ft. The back tangent gradient is -4 percent, the forward tangent gradient is 2 percent, and the elevation of the curve at station 48+50 must equal ..
Determine the concentration of bacteria : Assume A broth contains bacterial cells at a concentration on 10^5 cells per milliliter.  You dilute this broth through removing 1ml and adding it to 9ml.
Elevation of the curve turning point : Set up a table showing curve elevations at the PVC, at the PVT, and at the half-station points along the curve. Compute the station and elevation of the curve turning point.
Biochemist isolates a peptide hormone : A biochemist isolates a peptide hormone with the given sequence, Indicte the residues that could contribute a positive charge.
Program to calculate overtime pay for salary based employee : To calculate overtime pay for a salary based employee, first find hourly rate by dividing gross pay by 40, and then calculate overtime pay.
Text mining research paper : Select a different topic. Topics should be sufficiently specific avoiding general topics such as ‘What is Text Mining
Report on separate eligible bachelors : Calculate the numbers of married men, single men, married women and single women. Print these numbers on a student summary report. If any single men are over 30 years of age, print their names and ages on a separate eligible bachelors report.
Labrador genetics problem : When a yellow female Labrador retriever was mated with a brown male, half of puppies were brown and half were yellow. The same female, when mated to a brown male produced all brown puppies.

Reviews

Write a Review

Biology Questions & Answers

  Immune response to infectious disease

It is a very curcial concept to understand how the immune response is mounted against viruses, bacteria, protozoans and helminthes. For an effective immune response, both innate and adaptive immunity should work together.

  A review on advanced glycated end products (ages)

This Project report elaborates a critical review of important elements attached to Advanced Glycated End Products (AGEs). It is very crucial to understand the process called Millard reaction.

  Plastic as a soil stabilizer

Soil stabilization is the permanent physical and chemical alteration of soils to enhance their physical properties. Stabilization can increase the shear strength of a soil and control the shrink-swell properties.

  Principles of microbiology

This assignment has three parts which contains questions related to Microbiology. It contains basic principles of microscopy, staining techniques in microbiology and microbial growth in the food industry.

  List the biologic functions

Lipid metabolites are often seen as key elements in cellular signaling. Is this unique? Please provide several examples of the function of lipids as key elements in signal arrays and list the biologic functions these signals affect?

  Biologic function relationships

Please describe how one might search for chemical structure, biologic function relationships, involving small molecular weight lipophylic compounds. Provide one example.

  Case study on patient in the haematology laboratory

Write a case study which detailing a scenario of a patient being investigated in the Haematology laboratory.

  Use of pcr and genetic approaches in biotechnology

The use of PCR and genetic approaches in biotechnology

  Describe the role of this enzyme in honey

Glucose oxidase is an enzyme that can be used for measurements of glucose levels by combining this reaction with an oxygen probe.

  Genetic problems

What phenotypic ratio would you get if you crossed a white mouse and a heterozygous brown mouse?

  Prepare an essay on nosocomial infection

Prepare an essay on nosocomial infection.

  Monitoring and recording the blood pressure

To increase the awareness of monitoring and recording the blood pressure of patients and practice measuring blood pressure in a safe environment.

Free Assignment Quote

Assured A++ Grade

Get guaranteed satisfaction & time on delivery in every assignment order you paid with us! We ensure premium quality solution document along with free turntin report!

All rights reserved! Copyrights ©2019-2020 ExpertsMind IT Educational Pvt Ltd