Biochemist isolates a peptide hormone

Reference no: EM1384039

A biochemist isolates a peptide hormone with the following sequence:

ADSERNCQLVILLAWLPGVKVQCALLDRET

(a) Indicte the residues that could contribute a positive charge.

(b) Which residues that could contribute a negative charge.

To be totally honest, I have absolutely no idea how to approach this question, and my textbook isn't very helpful. Can someone please explain (clearly, and thorougly as possible, please!) how I am supposed to figure out which residues contribute what charge from a sequence??

Reference no: EM1384039

Questions Cloud

Differences in family since 1950 : Discuss some differences in family since the 1950's to the present? An explanation of why this occurred. Compare and contrast the differences in marriage and family with relation to race

Length of the curve-elevation of the curve at station : A vertical curve is to connect two tangents that intersect at station 50+00 and the elevation 500.00ft. The back tangent gradient is -4 percent, the forward tangent gradient is 2 percent, and the elevation of the curve at station 48+50 must equal ..

Determine the concentration of bacteria : Assume A broth contains bacterial cells at a concentration on 10^5 cells per milliliter. You dilute this broth through removing 1ml and adding it to 9ml.

Elevation of the curve turning point : Set up a table showing curve elevations at the PVC, at the PVT, and at the half-station points along the curve. Compute the station and elevation of the curve turning point.

Biochemist isolates a peptide hormone : A biochemist isolates a peptide hormone with the given sequence, Indicte the residues that could contribute a positive charge.

Program to calculate overtime pay for salary based employee : To calculate overtime pay for a salary based employee, first find hourly rate by dividing gross pay by 40, and then calculate overtime pay.

Text mining research paper : Select a different topic. Topics should be sufficiently specific avoiding general topics such as ‘What is Text Mining

Report on separate eligible bachelors : Calculate the numbers of married men, single men, married women and single women. Print these numbers on a student summary report. If any single men are over 30 years of age, print their names and ages on a separate eligible bachelors report.

Labrador genetics problem : When a yellow female Labrador retriever was mated with a brown male, half of puppies were brown and half were yellow. The same female, when mated to a brown male produced all brown puppies.

User Account

All Pages